DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: arg and Arg1

Sequence 1:NP_524875.1 Gene:arg FlyBaseID:FBgn0023535 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_058830.2 Gene:Arg1 RGDID:2150 Length:323 Species:Rattus norvegicus

Alignment Length:321 Identity:122/322 (38%)
Similarity:190/322 (59%) Gaps:16/322 (5%)


  Fly    22 STAPREPEQSLGIIGVPFAKGQAKQGVELAPDLLRQSSLRQVLQSSHDGLVIRDYGNLQYAVDEP 86
            |:.|:..|    |||.||:|||.:.|||..|..||::.|.:.|:.:...  :||:|:|.: ||.|
  Rat     2 SSKPKPIE----IIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYN--VRDHGDLAF-VDVP 59

  Fly    87 LLQQQRVHYHHIRNYADFMACNRALIEQVKLMLVENTQFLAIGGDHAIGFGSVAGHLQHTPNLSL 151
                ....:..::|.......|..|...|.......|..:.:||||::..||::||.:..|:|.:
  Rat    60 ----NDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCV 120

  Fly   152 VWIDAHADINLHSTSQSGNIHGMPVSFLLEQLRNTWQHA-GLQEIAPNCLPKDQLVYIGLRDIDP 215
            :|:|||.|||...|:.|||:||.||:|||::|:..:... |...:.| |:....:|||||||:||
  Rat   121 IWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTP-CISAKDIVYIGLRDVDP 184

  Fly   216 YEAFILNKVGIRYYAMDTIDRVGVPKIIEMTLDALNPQNK--IHVSFDIDALDSNVAPSTGTAVR 278
            .|.:|:..:||:|::|..:|::|:.|::|.|...|..:.|  ||:|||:|.||....|:|||.|.
  Rat   185 GEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVV 249

  Fly   279 GGLTLREGISIVEALRDTKRVQGVDLVEINPKLG-SERDVRTTVESGLEILKSMFGYRRSG 338
            |||:.|||:.|.|.:..|..:.|:|::|:||.|| :..:|..||.:.:.:..|.||.:|.|
  Rat   250 GGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREG 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
argNP_524875.1 Arginase 32..331 CDD:212515 115/303 (38%)
Arg1NP_058830.2 Arginase-like 9..303 CDD:212536 116/306 (38%)
Substrate binding. {ECO:0000244|PDB:1HQG, ECO:0000244|PDB:1HQH, ECO:0000244|PDB:1T5G} 126..130 3/4 (75%)
Substrate binding. {ECO:0000244|PDB:1HQG, ECO:0000244|PDB:1HQH} 137..139 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21813651
eggNOG 1 0.900 E1_COG0010
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 233 1.000 Inparanoid score I3281
OMA 1 1.010
OrthoDB 1 1.010 D1179130at2759
OrthoFinder 1 1.000 FOG0001514
OrthoInspector 1 1.000 T617639
orthoMCL 1 0.900 OOG5_128245
Panther 1 1.100 LDO PTHR43782
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.