DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: arg and car1

Sequence 1:NP_524875.1 Gene:arg FlyBaseID:FBgn0023535 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_595133.1 Gene:car1 PomBaseID:SPBP26C9.02c Length:323 Species:Schizosaccharomyces pombe

Alignment Length:324 Identity:109/325 (34%)
Similarity:177/325 (54%) Gaps:48/325 (15%)


  Fly    31 SLGIIGVPFAKGQAKQGVELAPDLLRQSSLRQVLQSSHDGLVIRDYGNLQYAVDEPLLQQQRVHY 95
            ::.||.:||:.||.|.|.||||:::..:.|.:            |...|.|:|:  ::|..:...
pombe    23 AVSIINMPFSGGQPKDGAELAPEMIEAAGLPE------------DLERLGYSVN--VVQNPKFKS 73

  Fly    96 HHIRNYADFMACNRALIE----------QVKLMLVENTQ----FLAIGGDHAIGFGSVAGHLQHT 146
            ..::.     ..|:||::          ||:.::.:..:    .:.|||||::..|:|.|.....
pombe    74 RPLKE-----GPNQALMKNPLYVSNVTRQVRNIVQQELEKQRIAVNIGGDHSLAIGTVEGVQAVY 133

  Fly   147 PNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLL---EQLRN--TWQHAGLQEIAPNCLPKDQLV 206
            .:..::|||||||||...:|.|.|:||.|:||.|   |.|..  .|....::|        .:|.
pombe   134 DDACVLWIDAHADINTPDSSPSKNLHGCPLSFSLGYAEPLPEEFAWTRRVIEE--------RRLA 190

  Fly   207 YIGLRDIDPYEAFILNKVGIRYYAMDTIDRVGVPKIIEMTLDALNP--QNKIHVSFDIDALDSNV 269
            :|||||:||.|...|.:..|..|.|..:|:.|:.:::||.|:.:||  :..||:|||:||.|..|
pombe   191 FIGLRDLDPMERAFLRERSITAYTMHDVDKYGIARVVEMALEHINPGRRRPIHLSFDVDACDPIV 255

  Fly   270 APSTGTAVRGGLTLREGISIVEALRDTKRVQGVDLVEINPKLGSERDVRTTVESGLEILKSMFG 333
            ||:|||.|.||||.||.:.|.|::.:|..:..||::|:||.||::.:.:|||:....|:::..|
pombe   256 APATGTRVPGGLTFREAMYICESVAETGSLVAVDVMEVNPLLGNKEEAKTTVDLARSIVRTCLG 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
argNP_524875.1 Arginase 32..331 CDD:212515 108/320 (34%)
car1NP_595133.1 Arginase 24..313 CDD:212515 107/316 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 177 1.000 Inparanoid score I1127
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001514
OrthoInspector 1 1.000 T631427
orthoMCL 1 0.900 OOG5_128245
Panther 1 1.100 O PTHR43782
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R79
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.