DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: arg and T21F4.1

Sequence 1:NP_524875.1 Gene:arg FlyBaseID:FBgn0023535 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001257027.2 Gene:T21F4.1 WormBaseID:WBGene00020658 Length:327 Species:Caenorhabditis elegans

Alignment Length:231 Identity:67/232 (29%)
Similarity:116/232 (50%) Gaps:16/232 (7%)


  Fly   109 RALIEQVKLMLVENTQFLAIGGDHAIGFGS---VAGHLQHTPNLSLVWIDAHADINLHSTSQSGN 170
            |.|..:.:.::....:.|..||||:...|:   ||..::...::.|:|:|||.|.:...||.:||
 Worm    76 RQLAHETRQVIENKEELLVFGGDHSCAIGTWSGVATAMRPVGDIGLIWVDAHMDAHTPDTSDTGN 140

  Fly   171 IHGMPVSFLLEQLRNTWQHAGLQEIAPNCLPKDQLVYIGLRDIDPYEAFILNKVGIRYYAMDTID 235
            ||||||:.||.....|....|  :..|..||.: |..:|:||.:..|..:|.|:|:|.:....::
 Worm   141 IHGMPVAHLLGFGDKTLVKIG--DRLPKLLPHN-LCMVGIRDYESAEQELLEKLGVRIFYAHEVE 202

  Fly   236 RVGVPKIIEMTLDALNPQNKI--HVSFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTKR 298
            :.|:..::: ....|..:|.|  .:|.|:|..|.:.||:.||....|:...|.|..:..:..||.
 Worm   203 KRGIQDVMQ-EAQYLVTRNTIGYGLSIDLDGFDVSYAPAVGTPSADGINALEFIKALLTIDLTKL 266

  Fly   299 VQGVDLVEINPKLGSERDVRTTVESGLEILKSMFGY 334
            : ..::||..|:..   |.:.|.|   :::.|:..|
 Worm   267 I-ATEIVEFLPRFD---DTQRTSE---QLVSSLVEY 295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
argNP_524875.1 Arginase 32..331 CDD:212515 66/227 (29%)
T21F4.1NP_001257027.2 Arginase 12..296 CDD:212515 67/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0010
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I3591
Isobase 1 0.950 0 Normalized mean entropy S1415
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1179130at2759
OrthoFinder 1 1.000 FOG0001514
OrthoInspector 1 1.000 T475346
orthoMCL 1 0.900 OOG5_128245
Panther 1 1.100 LDO PTHR43782
Phylome 1 0.910 0.955 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R79
TreeFam 1 0.960
1110.810

Return to query results.
Submit another query.