DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: poe and ubr-5

Sequence 1:NP_001260222.1 Gene:poe FlyBaseID:FBgn0011230 Length:5322 Species:Drosophila melanogaster
Sequence 2:NP_492389.1 Gene:ubr-5 WormBaseID:WBGene00009460 Length:2944 Species:Caenorhabditis elegans

Alignment Length:3460 Identity:605/3461 (17%)
Similarity:1007/3461 (29%) Gaps:1427/3461 (41%)


  Fly   679 SGNAPAASAGAG--------TSAGASTKWQTSMIRFSG-------AAGRYIHNLISTSLLSE--- 725
            ||....|.|..|        ..|.|....:..:|..||       |||:..:..:   :||.   
 Worm   102 SGEVKEAEAVKGEPSSRLHDVYARAGAAGEVEVIPLSGGMNTLRAAAGQAKYRRV---MLSNRAY 163

  Fly   726 -QLQSNLLQHLSI---SPWSTDTNTWPLQVYPSTLSVLVQILLLKPTQEKEAACLSVWHRLINTL 786
             :|:.||.:..|.   :|....||.      |..|...||.:|...:::.....|......:|..
 Worm   164 YRLRGNLGESRSYVLGAPRVPATNV------PEELINNVQQVLQGKSRDVIIRELQRTGLNVNEA 222

  Fly   787 VEGVCSSNTASDSDYEDLNIEHAQLLLFLFHSLNLMQKKSILLLTAGGVIRCAEVCRGISEDRPV 851
            |..:.|.:...:.|..|:..||             :..:.:|.:..|||              |.
 Worm   223 VNNLLSRDDGDEQDVLDVGGEH-------------LIPEELLQILEGGV--------------PP 260

  Fly   852 KNSQIMLLSRLLLFLEYLMKHLYNAPPELLD------QVRWNLFSVSSMPDTQKITDLLNCRTKL 910
            .:|..:.::..||..|          ..|||      ::|::....|.           :.:.|.
 Worm   261 GSSGAVAMAESLLERE----------DRLLDSLASRAEMRYHFGGASG-----------SKKPKA 304

  Fly   911 N--SYCRHDIEENFRKSAGEYGSSIRPTFYSLVMGDPEISYWAQEFKLDGLAWNFILCTPDKLKY 973
            |  ...:.|.|.|: |:..:.|..:.               |.:....||:        |:..|.
 Worm   305 NEKDKKKKDSETNW-KNCIQLGEHVE---------------WWRGAPGDGI--------PEHAKT 345

  Fly   974 PLLV----DALTDILSITDMS--MYSKEKDKEASMHNLCAIQYCFTIAWKLNLGLPPSTSHVESL 1032
            ...|    |....::|||..|  ||:..::.:           .::.||..:.||....:.|:: 
 Worm   346 DAPVKSEDDKANPVISITATSYQMYALHRNGK-----------MYSWAWDESEGLDDPLTIVKN- 398

  Fly  1033 KAERSPNLHSLMWSIRLPL--ASSHYLVVSSLIKQGMYTQYAETLWTHVGDIGADIKYSL-KQTI 1094
               |....|:.:.:...|:  .||..|.:|.|.:.|....:.:       :.||.:::|| .:|:
 Worm   399 ---RDHPDHATIGTHGNPVIQMSSSNLRISILTRSGHLVSWLD-------ECGAGVRFSLASETV 453

  Fly  1095 LGVEAFNSQMNGNGTPRLSDLILFDSLVAHM--QAVAWAN----KEGLKWPRKESEDAAGEQ--- 1150
                   ::::.:....:.||:..|.|.|..  ..:.|..    .|..:..:||.|:|..|:   
 Worm   454 -------TKISEDSVMAVQDLVTSDHLAAFRIDSIIHWCGIVPLVESTRSTKKEKEEADREKKKH 511

  Fly  1151 -SAGTSLTSS-----SNDPELYSSNESIDDQKLKQDDDGKLSSDLQKYNQLVNELMVKLMNSYQL 1209
             |.|.:..||     ||..|.: ..:.:..:|......|.:::.:...|.::..|:....::...
 Worm   512 VSFGEAPVSSIPAVQSNSIEFF-VGQQVQMKKAPLYPAGSVAAQIDTSNPMIGVLLEDCWSATDH 575

  Fly  1210 LSVIVRGQMLKQLSSSTPEK------------ALNLIVPIVSDKPAIMLELHAAFLKLLP----- 1257
            .          :..|.||::            .||...|.||       .......|.||     
 Worm   576 C----------RFRSMTPKEYDYELEVDGFIALLNGASPEVS-------SASGTSTKTLPGGRVS 623

  Fly  1258 ---NEDKQLIANEWP---------KCLMVNDFAFNGKQHPVEPYILNVIDAHIIELTRGSNYSTL 1310
               ..|:...:|..|         :..:..|..:..:....:...:.|:|.:::.:....|.|. 
 Worm   624 RKRTHDEADDSNSVPPTEFGRRRVEVWLAEDLVWIHEHRKRDVMTVQVVDNNLVAVKHVPNSSQ- 687

  Fly  1311 HTLKHCLKSILQ-LF-ELL----LPHRTANAEVETQLKQLLISSMLDMRTDYLQ----------- 1358
                   |.|.| || |.|    :|....:.|..|.:.::.:     ||.:.||           
 Worm   688 -------KPIFQSLFSERLEMDGMPQTVISIEKSTDIDKIRL-----MRKEDLQVIDKCPPRAPV 740

  Fly  1359 -------GHSEHCLREILSGLT--QEAQKLLLYEHMVG--YCYRM-----------LKEFAADLR 1401
                   .....|.|.|:|.:.  .|.:.|...:|:..  :.||:           :..|...:.
 Worm   741 ILQKELLKFDVDCNRTIVSMVADLNELRVLARSKHVERGMHMYRVSTNGKVISRRRVPVFLPSVE 805

  Fly  1402 QPQSAGPS------GGA-------------PLDQDR--------AMFNESML---------FAVL 1430
            :|...|.|      |.|             ||.:|.        ||.::.:|         |.||
 Worm   806 RPIFGGLSPKLISFGDARTLFLRDTAGQLIPLQRDALNGFREPPAMHSQPILHIATACRPSFNVL 870

  Fly  1431 KTMFK-------MLEKPVAVQAMR-QFFKDQRSGSLTTLLLSFTGTSLPVSYARKMLQFVNRLFQ 1487
            .:..|       ||..|...:... .|.||..|.....|.....|.|          ||::|||:
 Worm   871 ASCEKNSQWQGSMLIIPGVDRPWHSHFIKDGSSLMQMVLYCDADGVS----------QFLDRLFE 925

  Fly  1488 LSLQADSQFQHEDLVECFSE-LATVDVARLKQWLGHIIYGPNVSTDVSTSEALDTTCRMLTSILQ 1551
            |.:..  ...|.:..:..|| |.|:                   |....|..|....| |||..:
 Worm   926 LRMSC--TISHHEFRQIMSEQLFTI-------------------TSDLCSNVLHAAIR-LTSATK 968

  Fly  1552 PSSSSSSNAQTPTNMATVSAMPSISDQLDPMEIEYDCGTAAGGGESNPGTGGAAANT-----SQI 1611
             :|..|..|...|.|.|:  .|:.:..|.|.::..:....|....|:...|....:.     |::
 Worm   969 -NSEDSDKAVPDTTMPTL--FPTRNITLPPQDVSMEDAAPAEESSSSNMQGDEIDDEEEPRWSRV 1030

  Fly  1612 L-SLWQAAQPNPSEESSQACDHSDSERN---GALLLSFVKSLVKDQSKASQIA---PPLF--QAL 1667
            | |..:..|..||::|.:. ..:|||.|   |....||  |.|:.........   ||:.  ::.
 Worm  1031 LRSRPKREQVTPSKKSKKE-KRADSEENDEYGGENHSF--SAVRSDESGMPFGSPRPPMVRQKSA 1092

  Fly  1668 LQLGQTLISPP--------QEGCDFAD-------VLQIMIT--LADASPARGHV---ALFNTTLL 1712
            ||:..|.:..|        :|..::.|       |..:::|  |...:|.:..:   |....|.:
 Worm  1093 LQIIDTFLKHPAMFYDKDAEEHIEYVDEPDRLSAVKALLLTRDLNGMTPFQSAINQRAYGAATSI 1157

  Fly  1713 WLELAKLQLPDKHLKHAENVSAQLRYLSELLQSIGFRGSRQHNPPWDDELQTDIDELYDELAEEG 1777
            |..|  |||..:.:...:    :|:|:..     .|.....||                      
 Worm  1158 WRAL--LQLGFQTMSEEQ----KLKYIFP-----SFNVDESHN---------------------- 1189

  Fly  1778 EQDSLLDDSDEDTL-NNKLCTFSQTQKEFMNQHWYHCHTCNMINTVGVCSVCARVCHKGHDVSYA 1841
                 .|||....| .|.:|:|:.|.::.:||..|.|.||.:..::..||.||..||:.||....
 Worm  1190 -----ADDSPLFILCYNDVCSFTWTGEDHINQDIYECKTCGLTGSLCCCSECALTCHRNHDCRLK 1249

  Fly  1842 KYG-NFFCDCGAKEDGSCQALSRRIGSNEVRDSAGIGSYLPSHMSLLAGKKRSSLPVGQPVLTRK 1905
            :.. ..:|||..|...:|:||   |..||:         |..|:                     
 Worm  1250 RTSPTAYCDCWEKSSCNCKAL---IAGNEL---------LREHL--------------------- 1281

  Fly  1906 DSLTNERIAVLTKLLEPYRETLQHQDQWLLVVRCILEYFDLLLPSI-NENCMLYSIVGCHKRATA 1969
                      |::||:..|               :.||     |:. ||:.||:           
 Worm  1282 ----------LSELLKYTR---------------LFEY-----PNARNEHIMLF----------- 1305

  Fly  1970 ALERLHLLEQSFQVTDQLMFATLGSQEGAFENVRMNYSGDQGQTIKHLLSSGVVRRVAFCCLSSP 2034
                                                            |:..|:|:.        
 Worm  1306 ------------------------------------------------LARTVIRQT-------- 1314

  Fly  2035 HGRRQQLAVSHEKGKVTILQLSALLKQADASKRKLTLTQLSSAPIACTVISLAANPCNEDCLAVC 2099
              |.|..:........|.:|.|                |.|..|         .:..|....|..
 Worm  1315 --REQTYSQKRRSRYRTAMQTS----------------QSSGTP---------EHNLNPPKFAKT 1352

  Fly  2100 GLKECHILTFSSSGSTNEHIVVNP---------QLENGNYIKKAVWLPGSQTLLAVVTSDYVKIY 2155
            .|::|         ..|.::|:|.         |:|        :..||....:...||.::...
 Worm  1353 ALEQC---------CKNANVVMNSIRCGINKFGQME--------LATPGQLHFVQQSTSTHLDKL 1400

  Fly  2156 DLAVDTYSPKYYYLVAVGKIRDCTFVYQDGNYNMLTFASSGYIYTQQLDQQSLAVHGDFYVTNTL 2220
            ..|:.....|.|..:.||.:|           |:|    |..|...::||               
 Worm  1401 TFALSNKILKDYSSLFVGTLR-----------NLL----SAPIRDPRVDQ--------------- 1435

  Fly  2221 ELSHQHIKDIAGHIGGGGVSIYYSHTLQLLFYSYSCGRSFFSPLTNVSEGVKGIYHLDTNSASKS 2285
                    ||...:|....|:....||.:                |||...........:....:
 Worm  1436 --------DIEMWVGRFVRSLVRVLTLAI----------------NVSPLAPSTILAAEDPTDNA 1476

  Fly  2286 ASKGPLQPLVQWTEVTGH--PGLVYASMQTS-----NNPIILMITPERIYLQEIKAQSAKSRIMD 2343
            ..:.|.:...::.:.|..  ..||.:..::|     :...:.|||....:||::...:.      
 Worm  1477 TPRDPREDRSRYNQATFQVFHALVISKKESSKLSEKSASFVAMITRIMQFLQQLPTFAV------ 1535

  Fly  2344 VVGIRHAVAGVEKTTLLLLCEDGSLRIFSAQPEYTSFWLSPQVQP----------------FGNQ 2392
               ::.|:|.   ..:.....||.||              |.|.|                |.:.
 Worm  1536 ---VQLAIAA---DAIFEPVRDGMLR--------------PMVNPALAGNNHDPMDILEKYFTSD 1580

  Fly  2393 L-YSSTLMAKGGGSGSTSKSKSNTASGKMTSRKASQQQKQPTAGGQPVFPIDFFEHCNMLADVEF 2456
            | :|..|........:.:.||.:|...:.|||:.:.::                           
 Worm  1581 LSFSEVLKRSKKEERAIATSKPDTKRVRRTSRRDTDRE--------------------------- 1618

  Fly  2457 GGNDLLQIYNKQKLKTRLFSTGMFVASTRSNGFTLEVINNDPNVVIVGIRVLIGTQDVQRAPQSV 2521
            .|:|     |::.::           ..||.|                          .||.:|.
 Worm  1619 NGSD-----NRESME-----------DERSAG--------------------------DRASESQ 1641

  Fly  2522 TIL--------GRTIPTPVRRARWFDIPLTREEMLQSDKLLKVVFAKAPDPEHVTLLDCIEVYGK 2578
            ..|        ..|:|||.||                 :||      :.:..:.|..|..|..|:
 Worm  1642 ETLRIRHDSTATSTVPTPRRR-----------------RLL------SGNTTNDTNEDNEERNGQ 1683

  Fly  2579 SKELVGW--------------------PDESEDVTVPGSSAPAVSSSQASSANFGEGFNCITQLD 2623
            .:|..|.                    .|:.:|.....|..||....:......|:..    :.|
 Worm  1684 PREFDGESSSSDDDNDDDDDDDDEEEDDDDDDDDDDEDSDRPAEERQEDEEREEGDEH----EQD 1744

  Fly  2624 RMANHLLEVMDCALHLLGSGVPASMRQKAVKTASALLLLPTPNPVQTQARYVLATLYGTRALYHN 2688
            ......:||:|..                                                    
 Worm  1745 EQVEGEIEVVDRI---------------------------------------------------- 1757

  Fly  2689 YKDGVLLQFVNRELQSMQPKLEKLETLRE-----IDPEAFYRLVLMVRGIANARPQSLAKICVEN 2748
                           .:||.:|:.|...|     .:|             |:..|:       :.
 Worm  1758 ---------------EVQPVVEESERAEEPVWHAYEP-------------ASPSPR-------QP 1787

  Fly  2749 NYDIVPTLMGIVLELHKVTPTLDEPVNIVKRGLCQPETIVHCLVEIMYGFALADPGQVGRMTKYF 2813
            ::|                   |...:..:.|..:|            .|.:||           
 Worm  1788 DFD-------------------DNSSDSQEGGAREP------------AFVIAD----------- 1810

  Fly  2814 IDLLKHDASVISHSAKEALILLLSPRMKRRKVAIVTPPACSTPTPSTSTMQALQAAASSAASDII 2878
                      ::|..:.|       :.:...|.||.|.|   ..||.|.|.::  ||||||.:..
 Worm  1811 ----------VAHPLEVA-------QAQPANVPIVRPVA---ENPSPSIMASI--AASSAARERA 1853

  Fly  2879 EEAAGVVVDGSVGGGGLPEPNADAEGAAVGVGGVGQQQMLNLEAFMGGGFPRLLGLPEDADDEAI 2943
            .||.                 |:..|||.             ....|...||:         |..
 Worm  1854 LEAL-----------------AERRGAAA-------------SRVPGSSVPRI---------ERF 1879

  Fly  2944 MDIAIALSLQQHGGDANALQSLQQGLANLQGIRQATAMAAAVNAAANVSLGGSDDDEGSNVATDG 3008
            :.       .:....::.|.:.::..:|.||   :|...||          ||....||      
 Worm  1880 LP-------YRFSSRSSFLSNRREDSSNSQG---STLSYAA----------GSTTGTGS------ 1918

  Fly  3009 STLRTSPAEPAGSGGSESGGSGVESI--GGTSARSSNFGDHANASPPRQGSTKDDQEQPGPS--- 3068
                |:||..:.:.|:.:  |.|.|:  ..|:..|||    ..:||....|.|.:.....||   
 Worm  1919 ----TAPAPASATAGNNN--SQVRSVPPPTTTTSSSN----QESSPASNSSKKSNDNTDQPSLET 1973

  Fly  3069 ---------GVAGSGGVAVLSAM--------SSSEDNEANEDDKLSKLH---------------- 3100
                     .|....|..:||.|        :.::||......|..:|.                
 Worm  1974 AREQLALTFSVLVRAGCDILSRMPRPVMSVYTKADDNAKRSQLKAQRLFGDILQDTFRWMGRVFE 2038

  Fly  3101 --DLRIAVLESIIQHL------GTFDLCNGLQAIPLIQVILMLTTD------------------- 3138
              :.:|...|:..:.|      |:.|......|:..|..:|.|.||                   
 Worm  2039 STEAKINFNETYEKSLVRPASPGSEDKRGRKDALHYIHSLLRLATDEAKDSLAHVDIEMLYPVAL 2103

  Fly  3139 --------LNGNNERDQQVLHDLLTALVDYVEIGKR----------------------------- 3166
                    |:.|.||..:     |..|:||.|..:|                             
 Worm  2104 VADAYFHFLSCNVERPIE-----LKQLIDYYEDSQRRHFREKCEQTDNDLMIGFFMRPVSLSWPG 2163

  Fly  3167 ----GA------------AARMETKCP--GNEVRLALLS----LF-GVLMGKTKSKQTGTTSPPH 3208
                ||            ..::|.:||  |....|.:|:    || ..::.:||.:.:...:.| 
 Worm  2164 HLHDGAWDTLSGRHHISKTLKIEEECPMLGGPKMLTMLTKQEDLFRDPVIDETKRRTSSYLNDP- 2227

  Fly  3209 QFKDNSSFVASTTANVLSKSGAFVYALEALNTLLVHWKNVLGDPYAAGGGLASQSAQASGGASGP 3273
                    |...|.|:|.:  .|.|                                     ..|
 Worm  2228 --------VEEYTYNLLDR--PFEY-------------------------------------RNP 2245

  Fly  3274 GVQLLKPIKHGPKPD---ISILIPHNYLKNYPD-----------IFESYDGLLTEIIVRLPYQIL 3324
            ||.|.. :.|..|.:   |||.....:|...||           .|..|.|.|.:.|.:....:|
 Worm  2246 GVSLAM-VPHRLKLEREFISITRDFYHLDRTPDHEVKDYSTAVGKFPGYIGRLDDSISKFKDNLL 2309

  Fly  3325 RLSSAHPDNYDS-----------GFCEAMTFTLCEYMMLNLNTLLRR------------------ 3360
            ..|......|.|           .|.:.||..|...:....:.:|||                  
 Worm  2310 IHSCNRERLYFSKWFKTLNAIGNRFYDKMTEALGADVAFENSIMLRRLASFETKQRLFNKATEKY 2374

  Fly  3361 -----QVRKLLMYICGSKEKFRMYRDGHSLDAHFRVVKRVCNIVSSKTG---------------- 3404
                 .|:::::.:  .:|...::|| ..:..|....||:.::.|.::|                
 Worm  2375 RTQHSNVKEIVLDV--RREPGSLFRD-TMVQLHHLYAKRMMSVRSLESGHAPLAGTRLRVHFIDE 2436

  Fly  3405 -----------------------APYNANP-------------PMLSYDALVELTEHLRTC--QE 3431
                                   ||:....             |...|:..:|:|:.||..  ::
 Worm  2437 PGEGTGVTRSFYTAFAESCMMDVAPFTPETVAEKSSLIQSVLHPNNEYEHDMEITKTLRKARREQ 2501

  Fly  3432 ISQMRT-------------------------GNWQKFCV----------------VHEDALAMLM 3455
            ..::||                         |||.|..:                .||..|..:.
 Worm  2502 AIRLRTHLQRLKTFPLNLAAPRFDIKNFTGEGNWTKKVLQDSSAESQPVAPLNWGQHEGTLRKIH 2566

  Fly  3456 EIACYQLDDGVSPIIIQLLQAAVCNLPPPSGSK----------QAQPQPSTSSASGKL------- 3503
            .:....|.|..:   |..:...:|.||.....|          ..|...:...|.|:|       
 Worm  2567 TMTSGFLTDEKT---IGRVMGIMCQLPTEVFVKAVNNDDTMRLHIQQILAELRAEGELDDYSRVF 2628

  Fly  3504 ----RTDREKSED--------TDAYYSK-FDPAQCGTF-VHQI-----FRYACDALIIRFVRIFL 3549
                ..::.:|:|        |::...: |:.|..|.| |.:|     .|.|....:.|.:.|.|
 Worm  2629 RGLQNAEQPRSDDEQWNVLVGTESPLDQLFEKAPYGEFYVPKIGNGAPMRLAAYRTVGRIMGICL 2693

  Fly  3550 LENNITQLRWQAHSF 3564
            .:.:|..||:..|.|
 Worm  2694 SQGDIFPLRFSRHIF 2708

Known Domains:


GeneSequenceDomainRegion External IDIdentity
poeNP_001260222.1 ZnF_UBR1 1794..1862 CDD:197698 24/69 (35%)
DZR 3793..3837 CDD:289539
E3_UbLigase_R4 4493..5296 CDD:290481
ubr-5NP_492389.1 E3_UbLigase_EDD 182..233 CDD:288409 11/57 (19%)
ZnF_UBR1 1202..1271 CDD:197698 24/72 (33%)
HECTc 2576..2942 CDD:238033 28/137 (20%)
HECTc 2614..2941 CDD:214523 22/96 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.