DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gug and atn1

Sequence 1:NP_001261581.1 Gene:Gug FlyBaseID:FBgn0010825 Length:2007 Species:Drosophila melanogaster
Sequence 2:XP_004915839.1 Gene:atn1 XenbaseID:XB-GENE-6458762 Length:1141 Species:Xenopus tropicalis

Alignment Length:1341 Identity:319/1342 (24%)
Similarity:419/1342 (31%) Gaps:530/1342 (39%)


  Fly   930 KSSPYGPPPESPIDASARSTPGQDSQGSNSNSQPPSMPPQPQ----------------------- 971
            |....||..|.  .|..|::||..|..|:.:......|...:                       
 Frog    33 KKESVGPREER--RARGRASPGAISTSSSDSKSEKGRPSGKKGRMEDSVPKNSKRERVKDSSESE 95

  Fly   972 ------QFQSPHPSPHMPSPAGGGLPPGMHPQNLIHGPPPGAAGGSGPQPPPPPTSLHQPTPTSA 1030
                  |.::...||.:|.|     ||   ....:.|......|||.|:      .:.|...:::
 Frog    96 GEAGKTQKKAKMESPEVPRP-----PP---DDESLDGQSGNEDGGSDPR------DIDQDNRSTS 146

  Fly  1031 GPPSLQHGLHPGHQHSQLSVASSIP-PSSIGIPPTLSTMAPSHMHPHLHPHAHLQGLHRPHDLPP 1094
              ||    ||.|...|.   |||:| |.|.   |.....:|        |......:..|..|||
 Frog   147 --PS----LHSGDSESD---ASSVPSPKSF---PLYRGSSP--------PRPSSSPISEPTVLPP 191

  Fly  1095 ---------SMHPHAPMPLSLQGHPQHGHGLPPSHTSQQQQQQQQQQQPGGPAGTVRT--PSPAQ 1148
                     .:.|.||.|.    .|.|...|.||:                 .|.|:.  |.|||
 Frog   192 PSQAPQTATQIEPQAPRPY----QPTHLPQLYPSN-----------------GGLVKAGPPQPAQ 235

  Fly  1149 QPPRSMHDPQSSREPPTSQPSTTMAGSSGPGGPPPQQSPHAHRTSPLPGLAGSGPPPPGLIGHPM 1213
            ..|           |||    |.:||.   |.|.|..||.|..::| ...:.|            
 Frog   236 VKP-----------PPT----TPIAGL---GSPRPLGSPTAPASAP-TNCSSS------------ 269

  Fly  1214 AIHPHLAH-LPPGHPAHAALAHPGHHLLSHSIAGLGPGGGPIALLAGPGGLGGIPESALSRRTP- 1276
            |.:||::| |||........|.||   |...:|  ...|.|:.           |.||..|..| 
 Frog   270 ASYPHVSHNLPPPPALRPLNASPG---LQSQVA--EKVGQPLP-----------PTSASLRYPPY 318

  Fly  1277 ----PSHLPHSHASSAPLTAHSVASMTSTSMSLTTSTVPSSAFSRASPSVQISSSGGGPSGPGSV 1337
                ||:.||.:.:..........              |.|::.::  .:.....|||||.|.. 
 Frog   319 PGQYPSNYPHPYPTQGKYNQPQPG--------------PHSSWGQS--GLNYGRGGGGPSYPQP- 366

  Fly  1338 GPGGMPNSSAAAAAAAAAHRAASPASSVSSLSRQSPLHPVPQSPLSHHPSSSALSAAAAAVAERD 1402
                 |..:..||..........|.....|...||||:..|..|   ||::..:.:.|:.::...
 Frog   367 -----PPQNGQAAGGGQNIAGGFPPPHHGSARAQSPLNNHPPHP---HPTTGGIQSPASQISVLH 423

  Fly  1403 RH---ALMRQQSPHMTPPPVSNASLMASPLSKMYAPQ--PGQRGLGTSPPPHLRPGASPPVIRHP 1462
            .|   :..|.|||:             .||:..:.|.  | .||...:|..:|.||::|.....|
 Frog   424 SHGGASGTRGQSPN-------------HPLNNAHHPHILP-NRGRSPTPQSNLTPGSTPQSGHQP 474

  Fly  1463 QMPLPLPLIAP--------------GGG--------------IPQIGVHPGQSPYPHPL------ 1493
            ...||..:|:|              ||.              :||.....|...||.|.      
 Frog   475 AHILPGGIISPNPPPQNNTQLTSSTGGSARGQSPAPTNTPHLLPQSNSSSGSMAYPAPAEPSNPP 539

  Fly  1494 -LHPSVFYSPHHHPFNSPYGYAPYGPGFPAYMKPPPQPGQLDPAAVMAAHHAGLQGPPPQQMRQD 1557
             .||  .|.||..|  |...|.|....:|.|      |.|            |.:|.||      
 Frog   540 STHP--VYQPHSSP--SVCQYPPSSQTYPNY------PFQ------------GYKGAPP------ 576

  Fly  1558 EQNAAAAAAQAAAEKQHQAAAAAAAQQHKAPQQQQPGGMPPNKPPTPKTPQGPGGGMPPGMGGPG 1622
                                 ||...:...|...:||..|.:.||.|               ..|
 Frog   577 ---------------------AAPPYKTAPPPPYKPGSFPASTPPPP---------------SQG 605

  Fly  1623 TPTGLPPGAYPGSHMPGYPQGPPHGSPFAPQDGQPHGLKPTSHMDALRAHAHSANSAGMGGGHHP 1687
            .....||...|.      ||..|...|                                    .|
 Frog   606 FKEASPPATAPA------PQPVPQPVP------------------------------------QP 628

  Fly  1688 TEPLPIDIEPDPEPEI----PSPTHNIPRGPSPEAKPDDTECHRSQSAIFVRHIDRGDYNSCTRT 1748
            ..|.|:.|:.:|..|:    .||...: ..|||..|..||..|.||||.|.:|:||| ||||.||
 Frog   629 PAPAPVQIKQEPPEEVEGEGESPVPPV-SSPSPPPKLVDTPSHASQSARFNKHLDRG-YNSCCRT 691

  Fly  1749 DLIFKPVADSKLARKR-----------EERDRKLAEKERERRQQQQQQ--------------QQQ 1788
            ||.|.|:..|||::||           |:|.|:..|:||||.::.::.              .|.
 Frog   692 DLYFVPLEGSKLSKKRSEQIERARRESEQRAREERERERERERELERNTKLDSRSHDCPQLCTQP 756

  Fly  1789 QQQQQAAAAQQAAQQAKMKAELKPPYA----------DTPALRQLSEYARPHVAFSPVEQMV--- 1840
            .....:.|....:..|......:||.|          ||||||.||||||||| .||..:..   
 Frog   757 PSHHPSLALPSPSSAANRPPHFEPPGAVAAVPPYLGPDTPALRTLSEYARPHV-LSPAGRAQPPG 820

  Fly  1841 -PYHHPM-------------------GPMYRERELEEIKNAQAAAASQSRLDPHWMEYYRRGIHP 1885
             |.|||.                   .|...||||.| :...........|||         :||
 Frog   821 HPPHHPFYLPLGDPLLAYNLPAVFASDPARAERELRE-RLKPGYEVKPGELDP---------LHP 875

  Fly  1886 SQFPLYANP----AISQMERERLGIPP--------PHHVG-------------------LDPG-- 1917
            |..||...|    |..|......|:||        |:|.|                   ..||  
 Frog   876 SSIPLPPPPPHHHAPHQPPPSAAGVPPQMALHPAFPYHHGQHAHAHALERERLALGAAAAGPGGA 940

  Fly  1918 ------------------------EH----------------MIRLTREYHAHSHTHLHLPLHPQ 1942
                                    :|                |:.:|..:|.|||.|.||.||.|
 Frog   941 QGATAAAGAGRGELSYAERLAAERQHAERVAALSGDPLARLQMLNVTPHHHQHSHIHSHLHLHQQ 1005

  Fly  1943 PQPPEAGFQLPPNVG-----------QYPR---PNMLIPREPH-SDVLLR--------------- 1977
            .....|...:.|.:.           .||.   ||.|||...| ||||.:               
 Frog  1006 DAIHAASAAVHPLMDPLASGSHLTRIPYPATTLPNTLIPHALHDSDVLRQQIFGEQTGNRQQQIW 1070

  Fly  1978 --------------MSYADQLQ--YLQAAEFQRQSLHDQYF 2002
                          :|.|.|||  :.|:||.||.:|..|::
 Frog  1071 ASPYRDLPSALSAPLSAAHQLQAMHAQSAELQRLALEQQHW 1111

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GugNP_001261581.1 ELM2 9..68 CDD:279754
SANT 125..172 CDD:197842
SANT_MTA3_like 126..171 CDD:212559
Sec_Non_Glob 344..>440 CDD:275213
atn1XP_004915839.1 Atrophin-1 17..1139 CDD:281189 319/1342 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C304397113
eggNOG 1 0.900 E1_KOG2133
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.