DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosbeta1 and Prosalpha2

Sequence 1:NP_652031.2 Gene:Prosbeta1 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster

Alignment Length:208 Identity:52/209 (25%)
Similarity:82/209 (39%) Gaps:34/209 (16%)


  Fly    12 VSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAAD-----TQAIA 71
            ||.|...:.:....||||..:::..|..|..:.| .::..|.:.:....||...|     .||..
  Fly    29 VSGGAPSVGIIASNGVVIATENKHKSPLYEQHSV-HRVEMIYNHIGMVYSGMGPDYRLLVKQARK 92

  Fly    72 DIVAYSLNYHENQTNKDALVFEAASEFRNYCYS-----YRESLLAGIIVAGWDEQRGGQVYSIPL 131
            ....|.|.|.| ......||...|:..:.|..|     :..|||    :.|||..|.....|.|.
  Fly    93 IAQTYYLTYKE-PIPVSQLVQRVATLMQEYTQSGGVRPFGVSLL----ICGWDNDRPYLYQSDPS 152

  Fly   132 GGMLTRESCTIGGSGSSFIYG--FVREHYRPNMALEDCVTFVKKAVQHAI--YHDGSSGGV---- 188
            |.....::..:   |.:.:.|  |:.:.|..::.|:|       ||..||  ..:|..|.:    
  Fly   153 GAYFAWKATAM---GKNAVNGKTFLEKRYSEDLELDD-------AVHTAILTLKEGFEGKMTADN 207

  Fly   189 VRIGIITKDGIER 201
            :.|||..::|.:|
  Fly   208 IEIGICDQNGFQR 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 49/204 (24%)
proteasome_beta_type_6 16..203 CDD:239731 49/205 (24%)
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 52/209 (25%)
proteasome_alpha_type_2 6..231 CDD:239719 52/209 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79068538
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.