DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and AT4G27585

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_567778.1 Gene:AT4G27585 / 828868 AraportID:AT4G27585 Length:411 Species:Arabidopsis thaliana


Alignment Length:243 Identity:47/243 - (19%)
Similarity:103/243 - (42%) Gaps:42/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RAIIFSRLGGIQSDIYSEGLHVRIPWF-QYPIIYDIRSRPRKISSPTG-SKDLQMINISLRVLSR 112
            :|.:..|.|...:.:.| |:|..||:. :...::.::.....|.:.|. :||    |:|:.:   
plant    70 KAFVIERFGKYATTLPS-GIHFLIPFVDRIAYVHSLKEEAIPIPNQTAITKD----NVSIHI--- 126

  Fly   113 PDSLNLPYLHKQL---GVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERAR 174
            ...|.:..:..:|   ||:.....:..:....::|.:.|....:...:|.    .:.:::||.  
plant   127 DGVLYVKIVDPKLASYGVESPIYAVVQLAQTTMRSELGKITLDKTFEERD----TLNEKIVEA-- 185

  Fly   175 DFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVE-RAKQEKQQKIVQAEGEAEA--- 235
             .|:...|..|..|.:        |.:.:......||...:: .|:::|:.:|:::|||.::   
plant   186 -INVAAKDWGLQCLRY--------EIRDIMPPHGVRAAMEMQAEAERKKRAQILESEGERQSHIN 241

  Fly   236 ---AKMLGLAVKQNPAYLKLRKLRAAQS-----IARTIASSQNKVYLS 275
               .|...:.:....|  |:.::..||.     :||..|:::..|.||
plant   242 IADGKKSSVILASEAA--KMDQVNRAQGEAEAILARAQATAKGLVLLS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 36/197 (18%)
AT4G27585NP_567778.1 HflC 62..330 CDD:223407 47/243 (19%)
SPFH_paraslipin 99..208 CDD:259811 20/130 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.