| Sequence 1: | NP_001097372.1 | Gene: | Phb2 / 46038 | FlyBaseID: | FBgn0010551 | Length: | 338 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_567778.1 | Gene: | AT4G27585 / 828868 | AraportID: | AT4G27585 | Length: | 411 | Species: | Arabidopsis thaliana | 
| Alignment Length: | 243 | Identity: | 47/243 - (19%) | 
|---|---|---|---|
| Similarity: | 103/243 - (42%) | Gaps: | 42/243 - (17%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    50 RAIIFSRLGGIQSDIYSEGLHVRIPWF-QYPIIYDIRSRPRKISSPTG-SKDLQMINISLRVLSR 112 
  Fly   113 PDSLNLPYLHKQL---GVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERAR 174 
  Fly   175 DFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVE-RAKQEKQQKIVQAEGEAEA--- 235 
  Fly   236 ---AKMLGLAVKQNPAYLKLRKLRAAQS-----IARTIASSQNKVYLS 275  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Phb2 | NP_001097372.1 | SPFH_prohibitin | 42..236 | CDD:259799 | 36/197 (18%) | 
| AT4G27585 | NP_567778.1 | HflC | 62..330 | CDD:223407 | 47/243 (19%) | 
| SPFH_paraslipin | 99..208 | CDD:259811 | 20/130 (15%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0330 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||