DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and PHB6

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001077924.1 Gene:PHB6 / 816575 AraportID:AT2G20530 Length:286 Species:Arabidopsis thaliana


Alignment Length:286 Identity:155/286 - (54%)
Similarity:216/286 - (75%) Gaps:9/286 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KLGKGGPPGLGIGLKVLAAV---GAAAYGVSQSLYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRI 73
            |:.||  ||.|    |:|||   |.:.||.:.:||.|:||||||:|:||.||:..:|.||.|:.|
plant     7 KVPKG--PGGG----VIAAVVIGGLSLYGATHTLYNVDGGHRAIVFNRLVGIKDKVYPEGTHLMI 65

  Fly    74 PWFQYPIIYDIRSRPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSIC 138
            |||:.|||||:|::|..:.|.:||:||||:.|.||||:||.:..||.:::.||.:|.|:|||||.
plant    66 PWFERPIIYDVRAKPYLVESTSGSRDLQMVKIGLRVLTRPMADQLPEVYRSLGENYRERVLPSII 130

  Fly   139 NEVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQV 203
            :|.||:|:|::|||||||||:.||..|||.|..||.:|:|.|||||:|.|:||||:|||||.|||
plant   131 HETLKAVVAQYNASQLITQRESVSREIRKILTLRAANFHIALDDVSITGLTFGKEFTAAIEGKQV 195

  Fly   204 AQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLAVKQNPAYLKLRKLRAAQSIARTIASS 268
            |.|||:||.|.||:|:|:|:..:::|||||::|:::|.|:..|.|:|.|||:.||:.||:||:.|
plant   196 AAQEAERAKFIVEKAEQDKRSAVIRAEGEAKSAQLIGQAIANNQAFLTLRKIEAAREIAQTISRS 260

  Fly   269 QNKVYLSADSLMLNIQDSGFDDMTEK 294
            .||||||::.|:||:|....|...:|
plant   261 ANKVYLSSNDLLLNLQAMDLDVKPKK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 114/193 (59%)
PHB6NP_001077924.1 SPFH_prohibitin 34..228 CDD:259799 114/193 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 224 1.000 Domainoid score I690
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5263
Inparanoid 1 1.050 311 1.000 Inparanoid score I737
OMA 1 1.010 - - QHG63567
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 1 1.000 - - FOG0002111
OrthoInspector 1 1.000 - - otm2842
orthoMCL 1 0.900 - - OOG6_101763
Panther 1 1.100 - - O PTHR23222
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1399
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.