DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and Stoml1

DIOPT Version :10

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_081218.3 Gene:Stoml1 / 69106 MGIID:1916356 Length:399 Species:Mus musculus


Alignment Length:187 Identity:40/187 - (21%)
Similarity:68/187 - (36%) Gaps:53/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSR-----PRKISSPTGSKDLQMINISLRV 109
            |.|:| |||.|::. ...|:.:.:|:.......|:|:|     |.|::|..|:           |
Mouse    87 RMIVF-RLGRIRNP-QGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGA-----------V 138

  Fly   110 LSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAK--FNASQLITQRQQVSLLIRKELVER 172
            ||             :|.|...:    |.:.||..:..|  ..|:::.........|:|:.|.| 
Mouse   139 LS-------------VGADVQFR----IWDPVLSVMAVKDLNTATRMTAHNAMTKALLRRPLQE- 185

  Fly   173 ARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQ---EAQRAVFFVERAKQEKQQKI 226
                      :.:.:|..|.:  ..:|...|.:.   |..|....||...|..|..:
Mouse   186 ----------IQMEKLKIGDQ--LLLEINDVTRAWGLEVDRVELAVEAVLQPPQDSL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 40/187 (21%)
Stoml1NP_081218.3 Tyrosine-type lysosomal sorting signal. /evidence=ECO:0000250|UniProtKB:Q9UBI4, ECO:0000255 6..10
SPFH_SLP-1 94..224 CDD:259814 33/171 (19%)
SCP2 312..396 CDD:460423
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.