DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and CG14644

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster


Alignment Length:229 Identity:53/229 - (23%)
Similarity:90/229 - (39%) Gaps:48/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RAIIFSRLGGIQ-SDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDL--------QMINI 105
            ||:|. |||.:: ......|:...:|......:.|||:|         |.||        .|:.|
  Fly    74 RAVIL-RLGRLRPKPPRGPGVIFLVPCIDDLAVVDIRTR---------SFDLHRQEILTRDMVTI 128

  Fly   106 SLRVLSRPD-----SLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLI 165
            |:      |     |:..|: ...|.|...|:....:....|::|........|::.::.:|..|
  Fly   129 SI------DGVVYYSIKSPF-DAMLQVYDPEEATEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQI 186

  Fly   166 RKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAE 230
            ...|......:.|.::.|.:.|:....:...|:..:|.|.:||              :.|:..|:
  Fly   187 EGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAVEQEAMREA--------------KAKVAAAQ 237

  Fly   231 GEAEAAKMLGLA---VKQNPAYLKLRKLRAAQSI 261
            ||.:|...|..|   ::.||..|:||.|:...||
  Fly   238 GERDAVTALKEAADIMETNPIALQLRYLQTLNSI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 42/199 (21%)
CG14644NP_649445.3 PHB 64..223 CDD:214581 34/165 (21%)
SPFH_like 89..292 CDD:302763 47/213 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.