DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and Mec2

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster


Alignment Length:229 Identity:50/229 - (21%)
Similarity:102/229 - (44%) Gaps:47/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDLQMI--NISLRVLSR 112
            ||||| |||.:.......|:     :|..|.|.:.    ||:       ||:.:  |:..:.:..
  Fly    97 RAIIF-RLGRLSGGARGPGM-----FFILPCIDEY----RKV-------DLRTVTFNVPQQEMLT 144

  Fly   113 PDSLNLPY-----------LHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIR 166
            .||:.:..           |:..:.|:........:....|::::...|.|:|:|:|:.::..::
  Fly   145 KDSVTVTVDAVVYYRISDPLYAVIQVEDYSMSTRLLAATTLRNIVGTRNLSELLTERETLAHNMQ 209

  Fly   167 KELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEG 231
            ..|.|....:.::::.|.:.::|.    ..:::....|:.||.|          :.:.|::.|||
  Fly   210 ATLDEATEPWGVMVERVEIKDVSL----PVSMQRAMAAEAEAAR----------DARAKVIAAEG 260

  Fly   232 EAEAAKMLGLA---VKQNPAYLKLRKLRAAQSIA 262
            |.::|..|..|   :..:|:.|:||.|:...||:
  Fly   261 EKKSATALKEASDVISASPSALQLRYLQTLSSIS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 40/198 (20%)
Mec2NP_573357.1 PHB 88..238 CDD:214581 31/161 (19%)
SPFH_like 107..314 CDD:302763 42/218 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.