DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and Nphs2

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_570841.3 Gene:Nphs2 / 170672 RGDID:620461 Length:383 Species:Rattus norvegicus


Alignment Length:293 Identity:68/293 - (23%)
Similarity:123/293 - (41%) Gaps:59/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PPGLGI--GLKVLAA----VGAAAYGVSQSLYTVEGGHRAIIFSRLGG-IQSDIYSEGLHVRIPW 75
            |.|||.  .|.||::    :....:.:...:..|:...|.||| |||. :.......||...:|.
  Rat    95 PSGLGACEWLLVLSSLIFIIVTFPFSIWFCIKVVQEYERVIIF-RLGHLLPGRAKGPGLFFFLPC 158

  Fly    76 FQYPIIYDIRSRPRKIS-SPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICN 139
            .......|:|.:..:|. ....:||:.::.|......|.::.:|  |...|.  :..|.:..:..
  Rat   159 LDTYHKVDLRLQTLEIPFHEVVTKDMFIMEIDAVCYYRMENASL--LLSSLA--HVSKAIQFLVQ 219

  Fly   140 EVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSL--------TE-----LSFG 191
            ..:|.::|..:.::::.:|:.:           |:|..:.||.|:.        ||     |..|
  Rat   220 TTMKRLLAHRSLTEILLERKSI-----------AQDVKVALDSVTCVWGIKVERTEIKDVRLPAG 273

  Fly   192 KEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLA---VKQNPAYLKLR 253
            .:::.|:||      ||||          :.:.:::.||||..|::.|.:|   :...||.::||
  Rat   274 LQHSLAVEA------EAQR----------QAKVRVIAAEGEKAASESLRMAAEILSGTPAAVQLR 322

  Fly   254 KLRAAQSIARTIASSQNKVYLSADSLMLNIQDS 286
            .|...||::   ....:.|.|.....|||:..|
  Rat   323 YLHTLQSLS---TDKPSTVVLPLPFDMLNLLSS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 45/208 (22%)
Nphs2NP_570841.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..73
SPFH_podocin 122..344 CDD:259809 57/256 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.