DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and Nphs2

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_569723.1 Gene:Nphs2 / 170484 MGIID:2157018 Length:385 Species:Mus musculus


Alignment Length:339 Identity:75/339 - (22%)
Similarity:132/339 - (38%) Gaps:91/339 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PPGLGI--GLKVLAA----VGAAAYGVSQSLYTVEGGHRAIIFSRLGG-IQSDIYSEGLHVRIPW 75
            |.|||.  .|.|||:    :....:.:...:..|:...|.||| |||. :.......||...:|.
Mouse    97 PSGLGACEWLLVLASLIFIIMTFPFSIWFCIKVVQEYERVIIF-RLGHLLPGRAKGPGLFFFLPC 160

  Fly    76 FQYPIIYDIRSRPRKIS-SPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICN 139
            .......|:|.:..:|. ....:||:.::.|......|.::.:|  |...|.  :..|.:..:..
Mouse   161 LDTYHKVDLRLQTLEIPFHEVVTKDMFIMEIDAVCYYRMENASL--LLSSLA--HVSKAIQFLVQ 221

  Fly   140 EVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSL--------TE-----LSFG 191
            ..:|.::|..:.::::.:|:.:           |:|..:.||.|:.        ||     |..|
Mouse   222 TTMKRLLAHRSLTEILLERKSI-----------AQDVKVALDAVTCIWGIKVERTEIKDVRLPAG 275

  Fly   192 KEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLA---VKQNPAYLKLR 253
            .:::.|:||      ||||          :.:.:::.||||..|::.|.:|   :...||.::||
Mouse   276 LQHSLAVEA------EAQR----------QAKVRVIAAEGEKAASESLRMAAEILSGTPAAVQLR 324

  Fly   254 KLRAAQSIARTIASSQNKVYLSADSLMLNIQDSGFDDMTEKVYKIGTGLPKDWLDARKMASKVAQ 318
            .|...||::                             |||...:...||.|      |.|.::.
Mouse   325 YLHTLQSLS-----------------------------TEKPATVVLPLPFD------MLSLLSS 354

  Fly   319 PAEKEKNVGNVASS 332
            |..:.:...|..||
Mouse   355 PGNRAQGSINYPSS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 45/208 (22%)
Nphs2NP_569723.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
SPFH_podocin 124..346 CDD:259809 59/282 (21%)
PHB 125..289 CDD:214581 41/195 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..385 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.