DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and AgaP_AGAP003352

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_003436453.1 Gene:AgaP_AGAP003352 / 1275027 VectorBaseID:AGAP003352 Length:390 Species:Anopheles gambiae


Alignment Length:255 Identity:61/255 - (23%)
Similarity:120/255 - (47%) Gaps:41/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LKVLAAVGAAAYGVSQ---SLY----TVEGGHRAIIFSRLGGIQS-DIYSEGLHVRIPWFQYPII 81
            ::|||.|.:....|..   ||:    .|:...||:|| |||.::| .....|:...:|.......
Mosquito    95 VEVLATVCSIVLMVLTLPISLFLCFKVVQEYERAVIF-RLGRLRSGGARGPGVFFVLPCIDNYCK 158

  Fly    82 YDIRS-----RPRKISSPTGSKDLQMINISLRVLSR-PDSLNLPYLHKQLGVDYDEKVLPSICNE 140
            .|:|:     .|:::.    ::|...:::...|..| .|.||.  :.:.....:..::|.:   .
Mosquito   159 VDLRTVSFDVPPQEVL----TRDSVTVSVDAVVYYRIRDPLNA--VVQVANYSHSTRLLAA---T 214

  Fly   141 VLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQ 205
            .|::|:...|.|:|:|:|:.:|..::..|.|....:.:.::.|.:.::|.    ..:::....|:
Mosquito   215 TLRNVLGTRNLSELLTEREAISHSMQVTLDEATDPWGVQVERVEIKDVSL----PDSLQRSMAAE 275

  Fly   206 QEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLA---VKQNPAYLKLRKLRAAQSIA 262
            .||.|          |.:.|::.||||.::::.|..|   :.::||.|:||.|:...|||
Mosquito   276 AEAAR----------EARAKVIAAEGEMKSSRALKEASDIMCESPAALQLRYLQTLSSIA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 44/204 (22%)
AgaP_AGAP003352XP_003436453.1 PHB 118..272 CDD:214581 33/167 (20%)
SPFH_SLP-4 138..345 CDD:259813 46/211 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.