DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and LOC100493429

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_031752208.1 Gene:LOC100493429 / 100493429 -ID:- Length:306 Species:Xenopus tropicalis


Alignment Length:221 Identity:51/221 - (23%)
Similarity:101/221 - (45%) Gaps:31/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRS-----RPRKISSPTGSKDLQMINISLRV 109
            ||:|| |||.:::.....|:...:|......|.|||:     .|:::.    :||...|.:...|
 Frog    87 RAVIF-RLGRVRNGAKGPGVFWVLPCADNIKIVDIRTVSFAVPPQEVL----TKDSVTIMVDAVV 146

  Fly   110 LSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERAR 174
            ..|..:..:..:.    ||...:....:....|::::...:.:|::.:|::::..:.|.|.|..|
 Frog   147 FYRVFNPTVAVVK----VDNASQATQMLAQTTLRNMLGTKSLTQILVEREEMAEQMSKILYEATR 207

  Fly   175 DFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKML 239
            |:.|.::.|.:.::..              .|..|||:.....|.::.:.|::.||||..|::.|
 Frog   208 DWGIRVERVEIKDVKL--------------PQSLQRAMAAEAEASRDARAKVIAAEGEMNASRSL 258

  Fly   240 ---GLAVKQNPAYLKLRKLRAAQSIA 262
               .|.:.:.||.|:||.|:....|:
 Frog   259 KEAALIMSETPAALQLRYLQTLSHIS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 41/190 (22%)
LOC100493429XP_031752208.1 SPFH_like 97..298 CDD:418525 44/210 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.