DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Bka and FCF1

Sequence 1:NP_524867.2 Gene:Bka FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_010626.1 Gene:FCF1 SGDID:S000002747 Length:189 Species:Saccharomyces cerevisiae

Alignment Length:200 Identity:118/200 (59%)
Similarity:143/200 (72%) Gaps:15/200 (8%)


  Fly     1 MGKHKKTQK---VKKQRNAQLKRIIKPTDARL-KDQIRVKRKKAEDPHQIKVHEATQQSSALFFQ 61
            |||.|||:|   ||:..|.:       .|.|| |:|..:|.|  |||...:  ...|.|||||||
Yeast     1 MGKAKKTRKFGLVKRTLNTK-------KDQRLKKNQENIKTK--EDPELTR--NIPQVSSALFFQ 54

  Fly    62 YNTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRI 126
            ||..:.|||.:::|||||||||:.|:|||:||||||.|||.|.|:|||.|||||||.||::||::
Yeast    55 YNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLGPKYRIALKL 119

  Fly   127 ISDPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIER 191
            ..|||.:||.|.|||||||||||.||.|||||||||||..||.|||||||:|:|.|..|.|.||:
Yeast   120 ARDPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLKQRIRKIPGIPLMSVGGHAYVIEK 184

  Fly   192 MPEAY 196
            :|:.:
Yeast   185 LPDVF 189

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 93/134 (69%)
FCF1NP_010626.1 PIN_Fcf1 51..185 CDD:189034 93/134 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C27762168
eggNOG 1 0.900 E1_COG1412
Hieranoid 1 1.000
Homologene 1 1.000 H5706
Inparanoid 1 1.050 226 1.000 Inparanoid score I742
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003856
OrthoInspector 1 1.000 T1136481
orthoMCL 1 0.900 OOG5_127679
Panther 1 1.100 LDO PTHR12416
Phylome 1 0.910 0.663 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R437
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.