DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bka and UTP23

DIOPT Version :10

Sequence 1:NP_524867.2 Gene:Bka / 46032 FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_115710.2 Gene:UTP23 / 84294 HGNCID:28224 Length:249 Species:Homo sapiens


Alignment Length:147 Identity:39/147 - (26%)
Similarity:69/147 - (46%) Gaps:8/147 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TQQSSAL----FFQYNTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAE 112
            |:|..|.    ||:.|..:..||.|:||..|...:::.::.:.:.:...|..:.....:.||..|
Human     4 TRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKE 68

  Fly   113 LEKLGNKYKLALRIISDPRFERLPCLHKGTYADDCLVERVRQ---HKCYIVATNDKDLKNRIRKI 174
            ||.||.....|..|....:....|.........:||:..|.:   |. |.|||.|::|..:::|.
Human    69 LETLGKDLYGAKLIAQKCQVRNCPHFKNAVSGSECLLSMVEEGNPHH-YFVATQDQNLSVKVKKK 132

  Fly   175 PGVPIMYVAAHKYAIER 191
            ||||:|::..:...:::
Human   133 PGVPLMFIIQNTMVLDK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1-like 60..190 CDD:350212 35/132 (27%)
UTP23NP_115710.2 PIN_Fcf1-Utp23-H 19..148 CDD:350214 34/129 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 180..249
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.