DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Bka and AT1G26530

Sequence 1:NP_524867.2 Gene:Bka FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_173975.4 Gene:AT1G26530 AraportID:AT1G26530 Length:178 Species:Arabidopsis thaliana

Alignment Length:198 Identity:95/199 (48%)
Similarity:122/199 (61%) Gaps:31/199 (16%)


  Fly     1 MGKHKKTQKVKKQRNAQLKRIIKPTDAR-LKDQIRVKRKK--AEDPHQIKVHEATQQSSALFFQY 62
            ||:.||.||.     |.:|.:|.....: .|:::....||  .|.|..:     ....|.|||.:
plant     1 MGRTKKPQKF-----AVMKMMISHKALKHYKEEVLNPNKKDLTELPRNV-----PSVPSGLFFSH 55

  Fly    63 NTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRII 127
            |:.|.|||.:::|||||||||:||:|:.:|||                ..:.|:.:.| ..| |.
plant    56 NSSLVPPYRVLVDTNFINFSIQNKIDLEKGMM----------------VFVRKMHSLY-YGL-IA 102

  Fly   128 SDPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERM 192
            .|||||||||:.||||||||||:||.||||:||||.|:|||.|||||||||||||...||:||::
plant   103 KDPRFERLPCVLKGTYADDCLVDRVTQHKCFIVATCDRDLKRRIRKIPGVPIMYVTQRKYSIEKL 167

  Fly   193 PEA 195
            |||
plant   168 PEA 170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 77/134 (57%)
AT1G26530NP_173975.4 PIN_SF 51..167 CDD:301351 77/134 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I1139
OMA 1 1.010
OrthoDB 1 1.010 D1338131at2759
OrthoInspector 1 1.000 T125052
orthoMCL 1 0.900 OOG5_127679
Panther 1 1.100 O PTHR12416
Phylome 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.