DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Bka and AT2G46230

Sequence 1:NP_524867.2 Gene:Bka FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_566068.1 Gene:AT2G46230 AraportID:AT2G46230 Length:196 Species:Arabidopsis thaliana

Alignment Length:198 Identity:115/199 (58%)
Similarity:142/199 (71%) Gaps:13/199 (7%)


  Fly     1 MGKHKKTQKVKKQRNAQLKRIIKPTDAR-LKDQIRVKRKK--AEDPHQIKVHEATQQSSALFFQY 62
            |||.||.||.     |.:|::|.....: .|:::....||  .|.|..:     ....:.|||.|
plant     1 MGKAKKPQKF-----AVVKKMISHKALKHYKEEVLNPNKKDLTELPRNV-----PSVPAGLFFSY 55

  Fly    63 NTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRII 127
            |:.|.|||.:::|||||||||:||:|:.:||.|||||.|.|.|:|||.|||||||.||::||||.
plant    56 NSTLVPPYRVLVDTNFINFSIQNKIDLEKGMRDCLYANCTPCITDCVMAELEKLGQKYRVALRIA 120

  Fly   128 SDPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERM 192
            .||.||||||:|||||||||||:||.||||:||||.|:|||.|||||||||||||...||:||::
plant   121 KDPHFERLPCIHKGTYADDCLVDRVTQHKCFIVATCDRDLKRRIRKIPGVPIMYVTNRKYSIEKL 185

  Fly   193 PEA 195
            |||
plant   186 PEA 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 97/134 (72%)
AT2G46230NP_566068.1 PIN_Fcf1 51..185 CDD:189034 97/134 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5706
Inparanoid 1 1.050 225 1.000 Inparanoid score I1139
OMA 1 1.010
OrthoDB 1 1.010 D1338131at2759
OrthoInspector 1 1.000 T125052
orthoMCL 1 0.900 OOG5_127679
Panther 1 1.100 LDO PTHR12416
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.