DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Bka and Fcf1

Sequence 1:NP_524867.2 Gene:Bka FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_082908.2 Gene:Fcf1 MGIID:1920986 Length:198 Species:Mus musculus

Alignment Length:199 Identity:136/200 (68%)
Similarity:159/200 (80%) Gaps:7/200 (4%)


  Fly     1 MGKHKKTQKVKKQRNAQLKRIIKPTDARLKDQIRVKRKKAE--DPHQIKVHEATQQSSALFFQYN 63
            |||.|||:|.     |.:||::...|.|||::.|:|.||.|  ||..:|..|..|..|.||||||
Mouse     1 MGKQKKTRKY-----ATMKRMLSLRDERLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYN 60

  Fly    64 TQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRIIS 128
            |||||||||::||||||||||.|||:||.|||||||||||.|:|||.||:||||.|:::||||..
Mouse    61 TQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKFRVALRIAK 125

  Fly   129 DPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERMP 193
            ||||:||||.|||||||||||:||.|||||||||.|:|||.||||||||||||::.|:|.|||||
Mouse   126 DPRFDRLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYLSNHRYNIERMP 190

  Fly   194 EAYG 197
            :.||
Mouse   191 DDYG 194

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 107/134 (80%)
Fcf1NP_082908.2 PIN_Fcf1 55..189 CDD:189034 107/134 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C27978781
eggNOG 1 0.900 E1_COG1412
Hieranoid 1 1.000
Homologene 1 1.000 H5706
Inparanoid 1 1.050 279 1.000 Inparanoid score I2888
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003856
OrthoInspector 1 1.000 T1084476
orthoMCL 1 0.900 OOG5_127679
Panther 1 1.100 LDO PTHR12416
Phylome 1 0.910 0.741 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R437
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.