DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Bka and fcf1

Sequence 1:NP_524867.2 Gene:Bka FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001017601.1 Gene:fcf1 ZFINID:ZDB-GENE-050417-67 Length:198 Species:Danio rerio

Alignment Length:199 Identity:135/200 (68%)
Similarity:158/200 (79%) Gaps:7/200 (4%)


  Fly     1 MGKHKKTQKVKKQRNAQLKRIIKPTDARLKDQIRVK--RKKAEDPHQIKVHEATQQSSALFFQYN 63
            |||.||.:|.     |.:||:|...|.|:|::.|.|  :||.|||..||..|..:..|.||||||
Zfish     1 MGKQKKQKKY-----ATMKRMISLKDQRIKEKDRAKTQKKKKEDPSAIKEQEIAKYPSCLFFQYN 60

  Fly    64 TQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRIIS 128
            |||||||:|::||||||||||.|||:||.|||||||||:|.|:|||.|||||||.||::||||..
Zfish    61 TQLGPPYYILVDTNFINFSIKAKLDVVQSMMDCLYAKCVPCITDCVMAELEKLGMKYRVALRIAK 125

  Fly   129 DPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERMP 193
            ||||:||||.|||||||||||:||.|||||||||.|:|||.||||||||||||::.|:|.|||||
Zfish   126 DPRFDRLPCSHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMP 190

  Fly   194 EAYG 197
            :.||
Zfish   191 DDYG 194

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 107/134 (80%)
fcf1NP_001017601.1 PIN_Fcf1 55..189 CDD:189034 107/134 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C27981383
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5706
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1338131at2759
OrthoFinder 1 1.000 FOG0003856
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12416
Phylome 1 0.910 0.759 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.