| Sequence 1: | NP_524867.2 | Gene: | Bka / 46032 | FlyBaseID: | FBgn0010520 | Length: | 200 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001017601.1 | Gene: | fcf1 / 550264 | ZFINID: | ZDB-GENE-050417-67 | Length: | 198 | Species: | Danio rerio |
| Alignment Length: | 199 | Identity: | 135/199 - (67%) |
|---|---|---|---|
| Similarity: | 158/199 - (79%) | Gaps: | 7/199 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MGKHKKTQKVKKQRNAQLKRIIKPTDARLKDQIRVK--RKKAEDPHQIKVHEATQQSSALFFQYN 63
Fly 64 TQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRIIS 128
Fly 129 DPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERMP 193
Fly 194 EAYG 197 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Bka | NP_524867.2 | PIN_Fcf1 | 58..192 | CDD:189034 | 106/133 (80%) |
| fcf1 | NP_001017601.1 | PIN_Fcf1 | 55..189 | CDD:189034 | 106/133 (80%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170580145 | |
| Domainoid | 1 | 1.000 | 168 | 1.000 | Domainoid score | I3806 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 1 | 1.000 | - | - | H5706 | |
| Inparanoid | 1 | 1.050 | 275 | 1.000 | Inparanoid score | I2927 |
| OMA | 1 | 1.010 | - | - | QHG54043 | |
| OrthoDB | 1 | 1.010 | - | - | D1338131at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0003797 | |
| OrthoInspector | 1 | 1.000 | - | - | oto39097 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_101337 | |
| Panther | 1 | 1.100 | - | - | LDO | PTHR12416 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X2651 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 13 | 12.910 | |||||