DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Bka and fcf1

Sequence 1:NP_524867.2 Gene:Bka FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001004999.1 Gene:fcf1 XenbaseID:XB-GENE-968525 Length:197 Species:Xenopus tropicalis

Alignment Length:198 Identity:132/199 (66%)
Similarity:153/199 (77%) Gaps:6/199 (3%)


  Fly     1 MGKHKKTQKVKKQRNAQLKRIIKPTDARLKDQIRVK-RKKAEDPHQIKVHEATQQSSALFFQYNT 64
            |||.|||:|.     |.:|:.|...|.|:|::.|.| :.|.||...||..|..|..|.|||||||
 Frog     1 MGKQKKTKKY-----AVMKKRISLKDQRIKEKDRAKIQPKKEDSSAIKEREVPQVPSCLFFQYNT 60

  Fly    65 QLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRIISD 129
            .|||||:|::||||||||||.|||:||.|||||||||:|.|:|||.|||||||.||::||||..|
 Frog    61 NLGPPYYILVDTNFINFSIKAKLDLVQSMMDCLYAKCVPCITDCVMAELEKLGQKYRVALRIAKD 125

  Fly   130 PRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERMPE 194
            |.||||||.|.|||||||||:||.|||||||||.|:|||.||||||||||||::.|:|.|||||:
 Frog   126 PSFERLPCSHPGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPD 190

  Fly   195 AYG 197
            .||
 Frog   191 DYG 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 105/134 (78%)
fcf1NP_001004999.1 PIN_Fcf1 54..188 CDD:189034 105/134 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C27979060
eggNOG 1 0.900 E1_COG1412
Hieranoid 1 1.000
Homologene 1 1.000 H5706
Inparanoid 1 1.050 265 1.000 Inparanoid score I2856
OMA 1 1.010
OrthoDB 1 1.010 D1338131at2759
OrthoFinder 1 1.000 FOG0003856
OrthoInspector 1 1.000 T1060457
Phylome 1 0.910 0.735 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R437
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.