DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Bka and CG17652

Sequence 1:NP_524867.2 Gene:Bka FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001259881.1 Gene:CG17652 FlyBaseID:FBgn0031361 Length:244 Species:Drosophila melanogaster

Alignment Length:133 Identity:39/134 (29%)
Similarity:67/134 (50%) Gaps:11/134 (8%)


  Fly    58 LFFQYNTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYI--SDCVRAELEKLGNKY 120
            :||..|.....||.:::|..|...:::.|:.|.:.:..  |.:|...:  :.||..|.|.||...
  Fly    14 VFFASNFDYREPYQVLIDATFCQAALQQKIGIDEQIKK--YFQCGVKLLTTQCVILESESLGAPL 76

  Fly   121 KLALRIISDPRFERLPCLHKG--TYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVA 183
            ..|..|:.  ||....|.|:|  ..|.:|:....:.:: |:||:.|:.|:..:|||||..::|: 
  Fly    77 TGATSIVK--RFHVHKCGHEGKPVPASECIKSMTKDNR-YVVASQDRLLQESLRKIPGRCLLYL- 137

  Fly   184 AHK 186
             ||
  Fly   138 -HK 139

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 39/134 (29%)
CG17652NP_001259881.1 PIN_Fcf1-Utp23-H 2..145 CDD:189036 39/134 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C27992005
eggNOG 1 0.900 E1_COG1412
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12416
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.