powered by:
                   
 
    
    
             
          
            Protein Alignment Bka and Utp23
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_524867.2 | Gene: | Bka / 46032 | FlyBaseID: | FBgn0010520 | Length: | 200 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001119738.1 | Gene: | Utp23 / 299900 | RGDID: | 1307179 | Length: | 249 | Species: | Rattus norvegicus | 
        
        
        
          
            | Alignment Length: | 147 | Identity: | 38/147 - (25%) | 
          
            | Similarity: | 68/147 -  (46%) | Gaps: | 8/147 - (5%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    52 TQQSSAL----FFQYNTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAE 112|:|..|.    ||:.|..:..||.|:||..|...:::.::.:...:...|..:.....:.||..|
 Rat     4 TRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQLRDQLPRYLMGETQLCTTRCVLKE 68
 
 
  Fly   113 LEKLGNKYKLALRIISDPRFERLPCLHKGTYADDCLVERV---RQHKCYIVATNDKDLKNRIRKI 174||.||.:...|..|....:....|.........:||:..|   ..|. |.|||.|::|..:::|.
 Rat    69 LETLGKELYGAKLIAQKCQVRNCPHFKSAVSGSECLLSMVDDGNPHH-YFVATQDQNLSVKVKKN 132
 
 
  Fly   175 PGVPIMYVAAHKYAIER 191||:|:|::..:...:::
 Rat   133 PGIPLMFIIQNTIVLDK 149
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_COG1412 | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 1 | 1.000 | - | - |  |  | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 3 | 2.810 |  | 
        
      
           
             Return to query results.
             Submit another query.