DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Bka and Fcf1

Sequence 1:NP_524867.2 Gene:Bka FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001037700.1 Gene:Fcf1 RGDID:1310899 Length:198 Species:Rattus norvegicus

Alignment Length:199 Identity:137/200 (69%)
Similarity:159/200 (80%) Gaps:7/200 (4%)


  Fly     1 MGKHKKTQKVKKQRNAQLKRIIKPTDARLKDQIRVKRKKAE--DPHQIKVHEATQQSSALFFQYN 63
            |||.|||:|.     |.:||::...|.|||::.|:|.||.|  ||..:|..|..|..|.||||||
  Rat     1 MGKQKKTRKY-----ATMKRMLSLRDERLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYN 60

  Fly    64 TQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRIIS 128
            |||||||||::||||||||||.|||:||.|||||||||||.|:|||.||:||||.||::||||..
  Rat    61 TQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKYRVALRIAK 125

  Fly   129 DPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERMP 193
            ||||:||||.|||||||||||:||.|||||||||.|:|||.||||||||||||::.|:|.|||||
  Rat   126 DPRFDRLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYLSNHRYNIERMP 190

  Fly   194 EAYG 197
            :.||
  Rat   191 DDYG 194

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 108/134 (81%)
Fcf1NP_001037700.1 PIN_Fcf1 55..189 CDD:189034 108/134 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C27983317
eggNOG 1 0.900 E1_COG1412
Hieranoid 1 1.000
Homologene 1 1.000 H5706
Inparanoid 1 1.050 280 1.000 Inparanoid score I2775
OMA 1 1.010
OrthoDB 1 1.010 D1338131at2759
OrthoFinder 1 1.000 FOG0003856
OrthoInspector 1 1.000 T1088024
orthoMCL 1 0.900 OOG5_127679
Panther 1 1.100 LDO PTHR12416
Phylome 1 0.910 0.737 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.