DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Bka and SPBC32H8.04c

Sequence 1:NP_524867.2 Gene:Bka FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001342993.1 Gene:SPBC32H8.04c PomBaseID:SPBC32H8.04c Length:192 Species:Schizosaccharomyces pombe

Alignment Length:194 Identity:116/195 (59%)
Similarity:146/195 (75%) Gaps:9/195 (5%)


  Fly     1 MGKHKKTQKVKKQRNAQLKRIIKPTDARL--KDQIRVKRKKAEDPHQIKVHEATQQSSALFFQYN 63
            |||.|.|:|.     ||:||:|...|.||  |||.:.|.|..::...::  |..|.:|.||||:|
pombe     1 MGKAKTTRKF-----AQVKRVINLKDQRLQKKDQKKEKEKTTKNGELVR--EIPQMASNLFFQFN 58

  Fly    64 TQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRIIS 128
            ..||||||:::|||||||.::.|:|:.:|:|.|||||.||.|||||.|||||||.:|::||||..
pombe    59 ESLGPPYHVIIDTNFINFCLQQKIDLFEGLMTCLYAKTIPCISDCVMAELEKLGIRYRIALRIAK 123

  Fly   129 DPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERM 192
            |.|||||||.|||||||||:|:||.|||||:||||||:||.|||||||:||:.||.||..:||:
pombe   124 DERFERLPCTHKGTYADDCIVQRVMQHKCYLVATNDKNLKQRIRKIPGIPILSVANHKIRVERL 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 94/134 (70%)
SPBC32H8.04cNP_001342993.1 PIN_Fcf1 53..187 CDD:189034 94/134 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5706
Inparanoid 1 1.050 236 1.000 Inparanoid score I821
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003856
OrthoInspector 1 1.000 T1125421
orthoMCL 1 0.900 OOG5_127679
Panther 1 1.100 LDO PTHR12416
Phylome 1 0.910 0.697 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R437
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.