DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Bka and C34E10.10

Sequence 1:NP_524867.2 Gene:Bka FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_498110.1 Gene:C34E10.10 WormBaseID:WBGene00016411 Length:232 Species:Caenorhabditis elegans

Alignment Length:142 Identity:43/143 (30%)
Similarity:70/143 (49%) Gaps:7/143 (5%)


  Fly    59 FFQYNTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLA 123
            |::||.:...||.:::|..|.|.:::.||::.:.:...|..:.....::||..||||.|.....|
 Worm    15 FYKYNYKFVAPYRVLVDGTFCNAALQEKLNLAEQIPKYLTEETHLMTTNCVLKELEKFGPLLYGA 79

  Fly   124 LRIISDPRFERLPCLHK-GTYADDCLVERVRQHKC----YIVATNDKDLKNRIRKIPGVPIMYVA 183
            ..|..  :||...|.|. ...|.|||....|:...    |::||.|.:|..::|.|.|.||||:.
 Worm    80 FVIAK--QFEIAECTHSTPRAASDCLAHLARRAASGKTKYLIATQDDELTEKLRAIVGTPIMYIK 142

  Fly   184 AHKYAIERMPEA 195
            .....::.:.||
 Worm   143 FKTVLLDNISEA 154

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 41/138 (30%)
C34E10.10NP_498110.1 PIN_Fcf1-Utp23-H 2..149 CDD:189036 41/136 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1412
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.