DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Bka and F30A10.9

Sequence 1:NP_524867.2 Gene:Bka FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_492523.1 Gene:F30A10.9 WormBaseID:WBGene00009266 Length:196 Species:Caenorhabditis elegans

Alignment Length:197 Identity:112/198 (57%)
Similarity:154/198 (78%) Gaps:5/198 (3%)


  Fly     1 MGKHKKTQKVKKQRNAQLKRIIKPTDARLKDQIRVKRKKAEDPHQIKVHEATQQSSALFFQYNTQ 65
            |||..|:    ..|.:.:.:::|.||.|:|::.||.|....|..::|:..|.:.|||:|.:||||
 Worm     1 MGKRLKS----NARKSAVNKLVKKTDNRIKEEQRVIRTPKVDEQELKLVRAPKISSAMFMKYNTQ 61

  Fly    66 LGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRIISDP 130
            ||||:|:::||||:||::||::|:.||.||||:||.|.|.:|||.|||||: .::|:||:::.||
 Worm    62 LGPPFHVIVDTNFVNFAVKNRIDMFQGFMDCLFAKTIVYATDCVLAELEKV-RRFKIALKVLKDP 125

  Fly   131 RFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERMPEA 195
            |.:||.|.|||||||||||:||.|||||||||.|:|||.||||||||||||:..|:::|||||:|
 Worm   126 RVQRLKCEHKGTYADDCLVQRVTQHKCYIVATCDRDLKRRIRKIPGVPIMYIVNHRFSIERMPDA 190

  Fly   196 YG 197
            ||
 Worm   191 YG 192

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 88/134 (66%)
F30A10.9NP_492523.1 PIN_Fcf1 54..187 CDD:189034 88/134 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C27762134
eggNOG 1 0.900 E1_COG1412
Hieranoid 1 1.000
Homologene 1 1.000 H5706
Inparanoid 1 1.050 245 1.000 Inparanoid score I2039
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1338131at2759
OrthoFinder 1 1.000 FOG0003856
OrthoInspector 1 1.000 T477642
orthoMCL 1 0.900 OOG5_127679
Panther 1 1.100 LDO PTHR12416
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R437
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.