DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and dpr21

DIOPT Version :9

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:305 Identity:66/305 - (21%)
Similarity:102/305 - (33%) Gaps:95/305 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 LPIYIWYESYPEHIEEGYKGR-----------VSRVSQDSPF--GSASLNLTNIRESDQGWYECK 228
            |.|.|..|:.|:|..|.....           :.||....|:  .||:.|:|:: ....|...|:
  Fly    11 LCILILKETCPQHFRENVTVTDLYLISENIVPMKRVLDRGPYFDTSATKNVTSL-VGITGHLNCR 74

  Fly   229 VVFLNRDPKQHKNGTWF-HLDVHAPPRFSVTPEDIIYVNLGDSIILNCQADGTPTPEILWYKDAN 292
            :..|.     :|..:|. |.|:|                                  :|...::.
  Fly    75 IKNLG-----NKTVSWIRHRDLH----------------------------------LLTVSEST 100

  Fly   293 PVDPSPTVGIFNDGT---ELRISTIRHEDIGEYTCIARNGEGQVSHTARV-------------II 341
            .........|:|..|   .|:|...:..|.|.|.|       |||.|..|             .|
  Fly   101 YTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYEC-------QVSTTPPVGYTMVFSVVEPITSI 158

  Fly   342 AGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPG-NVTVRWYREG------SPVREVAALETRVTIR 399
            .||..|.:.       .|..|..:|..|.:|. .::|:|....      ||...|:.:..:..| 
  Fly   159 LGGPEIYID-------LGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDI- 215

  Fly   400 KDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAY-LSVEYPAKV 443
            ....|:|......|||||.|..:|  .:.:|.:.: |..::||.|
  Fly   216 TTSYLLIQRASIADSGQYTCLPSN--ANSKSVNVHILKGDHPAAV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 21/86 (24%)
IG_like 137..229 CDD:214653 16/64 (25%)
I-set 253..341 CDD:254352 15/103 (15%)
IGc2 268..331 CDD:197706 10/65 (15%)
I-set 346..437 CDD:254352 23/98 (23%)
Ig 349..437 CDD:299845 22/95 (23%)
Ig 459..530 CDD:299845
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
dpr21NP_001163838.2 Ig 71..149 CDD:299845 22/123 (18%)
IG_like 71..140 CDD:214653 20/114 (18%)
IG_like 162..249 CDD:214653 22/96 (23%)
IGc2 169..242 CDD:197706 20/75 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.