DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and KIRREL2

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_954649.3 Gene:KIRREL2 HGNCID:18816 Length:708 Species:Homo sapiens

Alignment Length:628 Identity:149/629 (24%)
Similarity:220/629 (35%) Gaps:197/629 (31%)


  Fly   132 PEDAVHITAILGEGVIFNCHVEFPNDHPVPY--VLQWDKKVSETGS--DLPIYIWYESYPEHIEE 192
            |||.|   .:|||.....|.:.       .|  ::||.|.....|.  |||.:..|         
Human    30 PEDLV---VLLGEEARLPCALG-------AYWGLVQWTKSGLALGGQRDLPGWSRY--------- 75

  Fly   193 GYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKV--VFLNRDPKQHKNGTWFHLDVHAPPRF 255
                   .:|.::..|...|::..:...|:..|||:.  ..|...|.|        |.|..||. 
Human    76 -------WISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQ--------LHVLVPPE- 124

  Fly   256 SVTPEDI----IYVNLGDSIILNCQA--DGTPTPEILWYKDANPVDPSPTVGIFNDG-------- 306
              .|:.:    :.:..|....|.|::  |..||||:||::|          |:..||        
Human   125 --APQVLGGPSVSLVAGVPANLTCRSRGDARPTPELLWFRD----------GVLLDGATFHQTLL 177

  Fly   307 ---------TELRISTIRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMVPP------TNQTK 356
                     :.|.::...|:|...:.|.||:..........:.::    :..||      :..|.
Human   178 KEGTPGSVESTLTLTPFSHDDGATFVCRARSQALPTGRDTAITLS----LQYPPEVTLSASPHTV 238

  Fly   357 LEGEKVIFSCEAKAMPGNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEV 421
            .|||||||.|:|.|.|.....||.:.||||  :.|...|:.:..|.|.:..|:.        |||
Human   239 QEGEKVIFLCQATAQPPVTGYRWAKGGSPV--LGARGPRLEVVADASFLTEPVS--------CEV 293

  Fly   422 TNGIGDPQSASAYLSVEYPAKVTFTPTVQYLPFRLAGVV------QCYIKSSPQLQYVTWTKDKR 480
            :|.:|....::|       ..|.|.|.:|..|..::..|      .|..:.:| |..||||:   
Human   294 SNAVGSANRSTA-------LDVLFGPILQAKPEPVSVDVGEDASFSCAWRGNP-LPRVTWTR--- 347

  Fly   481 LLEPYQMKDIVVMANGSLL-FTRVNEEHQGQYACTPYNAQGTAGASGVMD------VLVRKP--- 535
                  .....|:.:|:.| ...|..|..|.|.|     :..||.||:..      :.|..|   
Human   348 ------RGGAQVLGSGATLRLPSVGPEDAGDYVC-----RAEAGLSGLRGGAAEARLTVNAPPVV 401

  Fly   536 ------PAFTVEPETL----YQRKVGDSVEMHCD------------------ALEAEGTERP-TI 571
                  |||...|..|    :.....|:|....|                  |.|:.|...| .|
Human   402 TALHSAPAFLRGPARLQCLVFASPAPDAVVWSWDEGFLEAGSQGRFLVETFPAPESRGGLGPGLI 466

  Fly   572 KWQRQEGEQLTE-------SQRNRIKISGGNITIENLRREDFGYYQCVVSNEVATLMAVTQLVIE 629
            ......|.|.::       |.|||:...|...::.  ||:.....:.|.....||   .|.|:: 
Human   467 SVLHISGTQESDFSRSFNCSARNRLGEGGAQASLG--RRDLLPTVRIVAGVAAAT---TTLLMV- 525

  Fly   630 GTQPHAPYNITG---------KATES---SITLQWLPGYSGGS 660
                     |||         ||:.|   ...|..:||.|.||
Human   526 ---------ITGVALCCWRHSKASASFSEQKNLMRIPGSSDGS 559

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 25/119 (21%)
IG_like 137..229 CDD:214653 20/96 (21%)
I-set 253..341 CDD:254352 22/111 (20%)
IGc2 268..331 CDD:197706 20/82 (24%)
I-set 346..437 CDD:254352 31/97 (32%)
Ig 349..437 CDD:299845 31/94 (33%)
Ig 459..530 CDD:299845 20/84 (24%)
IG_like 549..628 CDD:214653 22/105 (21%)
IGc2 551..617 CDD:197706 18/92 (20%)
FN3 633..725 CDD:238020 12/41 (29%)
FN3 786..874 CDD:238020
KIRREL2NP_954649.3 IG_like 30..119 CDD:214653 28/123 (23%)
IGc2 38..106 CDD:197706 19/91 (21%)
I-set 126..224 CDD:254352 21/112 (19%)
Ig2_KIRREL3-like 141..223 CDD:143236 19/96 (20%)
Cell attachment site. {ECO:0000255} 149..151 0/2 (0%)
Ig 231..306 CDD:299845 29/92 (32%)
IG_like 234..308 CDD:214653 29/91 (32%)
Ig 312..395 CDD:299845 23/98 (23%)
I-set 317..395 CDD:254352 21/93 (23%)
Ig 397..501 CDD:299845 21/104 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.