DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and Kirrel3

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:XP_006510620.1 Gene:Kirrel3 MGIID:1914953 Length:803 Species:Mus musculus

Alignment Length:911 Identity:193/912 (21%)
Similarity:315/912 (35%) Gaps:238/912 (26%)


  Fly   132 PEDAVHITAILGEGVIFNCHV-EFPNDHPVPYVLQW--DKKVSETGSDLPIYIWYESYPEHIEEG 193
            |:|.|   .:.|:.|...|.: |:..     :|| |  |......|.||      .|||:::..|
Mouse    54 PQDQV---VVSGQPVTLLCAIPEYDG-----FVL-WIKDGLALGVGRDL------SSYPQYLVVG 103

  Fly   194 YKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKVV---FLNRDPKQHKNGTWFHLDVHAPPRF 255
                 :.:|     |...|.:......|...|||:.:   ..:|                 |.|.
Mouse   104 -----NHLS-----GEHHLKILRAELQDDAVYECQAIQAAIRSR-----------------PARL 141

  Fly   256 S--VTPED-------IIYVNLGDSIILNCQADGT-PTPEILWYKDANPVDPSP-TVGIFNDG-TE 308
            :  |.|:|       :|.:..||.:.|.|.||.. |...|:|.:....::.:. :..:..|| .|
Mouse   142 TVLVPPDDPIILGGPVISLRAGDPLNLTCHADNAKPAASIIWLRKGEVINGATYSKTLLRDGKRE 206

  Fly   309 LRIST--IRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMV------PP------TNQTKLEG 359
            ..:||  |...|:       .||:..|.......|.||....|      ||      ..|..||.
Mouse   207 SIVSTLFISPGDV-------ENGQSIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPVLED 264

  Fly   360 EKVIFSCEAKAMPGNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNG 424
            ..|.|.|.|||.|.....||.:.|..::|.:....|.|:  |.:....|:.        |||||.
Mouse   265 NIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTV--DYTYFSEPVS--------CEVTNA 319

  Fly   425 IGDPQSASAYLSVEYPAKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKD 489
            :|. .:.|..:.|.:..::|..|....:......|..|....:|.|. :.|.|        :...
Mouse   320 LGS-TNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLT-IVWMK--------RGSG 374

  Fly   490 IVVMANGSLLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKV-GDS 553
            :|:....:|....|.:|..|:|.|.....:..||...| .:.|..||..:   .|..|..: |:.
Mouse   375 VVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREV-TLTVNGPPIIS---STQTQHALHGEK 435

  Fly   554 VEMHCDALEAEGTERPTIKWQRQEGEQLTESQRNRIKISGGNITIENLRREDFGYYQCVVSNEVA 618
            .::.|........:|....|:    |.:.||.      :.|..|:|.:..|:.......:||.| 
Mouse   436 GQIKCFIRSTPPPDRIAWSWK----ENVLESG------TSGRYTVETVNTEEGVISTLTISNIV- 489

  Fly   619 TLMAVTQLVIEGTQPHAPYNITGKATESSITLQWLPGYSGGSEYKQDYTIWFREAGVNDWQTISV 683
              .|..|.:...|    .:|..|..|| .|.|:     ..|||.|..       ||:   :..||
Mouse   490 --RADFQTIYNCT----AWNSFGSDTE-IIRLK-----EQGSEMKSG-------AGL---EAESV 532

  Fly   684 TPSGSTQVTINGLASGTTYEFQVVGRNVLGDGMMSKVMTVRTLEDAPAAPRNVKAATQPPDSFFQ 748
                 ....|.|:|.|....|.|         :|:.::       |....|:.::....|.    
Mouse   533 -----PMAVIIGVAVGAGVAFLV---------LMATIV-------AFCCARSQRSTGGRPG---- 572

  Fly   749 LMPDEADLLAYFDIYFHTDSRGTLVYSPPKLRVKGPKPGPPRNVSVTEVSNGFLITWQSPLERAH 813
                             ...|||    ..|.|::.|:....:.|...:......|..:.|.....
Mouse   573 -----------------ISGRGT----EKKARLRLPRRANLKGVVSAKNDIRVEIVHKEPSSGRE 616

  Fly   814 IVKFYTIK--------YRTDAQWKTLNRGQIRPEETQYLVKNLVGGRTYYFRVLANSEKSYESSD 870
            .....|||        ::.|:..|.|.  .::.||.::  :||......|:.|  |:.|.:.|:.
Mouse   617 AEDHTTIKQLMMDRGEFQQDSVLKQLE--VLKEEEKEF--QNLKDPTNGYYSV--NTFKEHHSTP 675

  Fly   871 EV-------------KFPVPARVKHKAITAGVVG-GILF-----FIVAIILSVCAVKICNKRKRR 916
            .:             |..||..:....|.:.:.| |.|:     |::.  :...::::|.:..:|
Mouse   676 TISLSSCQPDLRPTGKQRVPTGMSFTNIYSTLSGQGRLYDYGQRFVLG--MGSSSIELCEREFQR 738

  Fly   917 ---KQEKEFNMVAC--------------RITDARNIAANNHHLHNRSTGSISSGQVPLKKYKQTR 964
               .....|....|              :...|...:|::.| |::|:...|....||::..||.
Mouse   739 GSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSH-HSQSSSQNSDPSRPLQRRMQTH 802

  Fly   965 I 965
            :
Mouse   803 V 803

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 23/119 (19%)
IG_like 137..229 CDD:214653 22/95 (23%)
I-set 253..341 CDD:254352 24/102 (24%)
IGc2 268..331 CDD:197706 18/68 (26%)
I-set 346..437 CDD:254352 28/103 (27%)
Ig 349..437 CDD:299845 28/100 (28%)
Ig 459..530 CDD:299845 16/71 (23%)
IG_like 549..628 CDD:214653 16/80 (20%)
IGc2 551..617 CDD:197706 13/66 (20%)
FN3 633..725 CDD:238020 21/92 (23%)
FN3 786..874 CDD:238020 19/109 (17%)
Kirrel3XP_006510620.1 Ig 52..143 CDD:299845 28/131 (21%)
IG_like 54..143 CDD:214653 28/131 (21%)
IG_like 156..244 CDD:214653 24/95 (25%)
Ig2_KIRREL3-like 165..246 CDD:143236 21/88 (24%)
Ig_3 254..318 CDD:290638 22/74 (30%)
I-set 335..416 CDD:254352 18/91 (20%)
IGc2 349..400 CDD:197706 13/60 (22%)
Ig5_KIRREL3 418..515 CDD:143306 27/118 (23%)
IG_like 426..515 CDD:214653 24/107 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.