DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and igsf9ba

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:XP_009289969.2 Gene:igsf9ba ZFINID:ZDB-GENE-060503-729 Length:1475 Species:Danio rerio

Alignment Length:1527 Identity:417/1528 (27%)
Similarity:626/1528 (41%) Gaps:357/1528 (23%)


  Fly   114 VLVSLLALLAKNAQ-AHNIPEDAVHITAILGEGVIFNCHVEFP-NDHPVPYVLQWDKKVSETGSD 176
            ::.|:.:.....|| ||.:.|:...:||..||.|:..|.|..| |....|||::|.|    .|..
Zfish     8 LIASVFSTRGTAAQGAHGVREEPQFVTARAGESVVLGCDVSHPLNGQQTPYVVEWFK----FGVP 68

  Fly   177 LPIYIWYESYPEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKVVFLNRDPKQHKN 241
            :|.:|.:..||.|::..|.||.|.      .|.|||.:..:|..|||||||:|:.|.:......|
Zfish    69 IPFFINFRFYPPHVDPEYAGRASL------HGKASLQIEQVRSEDQGWYECRVLMLEQQYDTFHN 127

  Fly   242 GTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNCQADGTPTPEILWYKDANPVDPSPTVGIFNDG 306
            |:|.||.|:|||.||.||...:....|.||.|.|.|.|.|.|.:.|.::.:.:..:....: :||
Zfish   128 GSWVHLTVNAPPTFSDTPPQYVEAREGGSITLTCTAFGNPKPVVTWLREGDQLTSTRKYTV-SDG 191

  Fly   307 TELRISTIRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAM 371
            : |.:..|..||.|.|:|.|.:.:|:..||.|:::.|...|:.||.|.|....:...|:|:|:|.
Zfish   192 S-LTVQAITREDRGAYSCRAHSDQGEALHTTRLLVQGPPYIVTPPENITVNISQNAQFTCQAEAY 255

  Fly   372 PGNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLS 436
            |||:|..||.|...|.....|:.||.|..||:|||..:||:|:|:|.|..:|.:|...||||||:
Zfish   256 PGNLTYTWYWEEDNVYFKNDLKLRVRIFIDGTLIIYRVKPEDAGKYTCSPSNSLGISPSASAYLT 320

  Fly   437 VEYPAKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFT 501
            |:|||:|...|.|.|:|.:|:|:::|.:.::|.:..|.|.||...|...:......|.:||:...
Zfish   321 VQYPARVVNMPPVIYVPRKLSGIIRCPVDANPPVTSVRWEKDGYPLRIEKYPGWSQMTDGSIRVA 385

  Fly   502 RVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHCDALEAEGT 566
            .|.|:..|.|.|.|||..||.|.|....::::.||.|.|.|...|:::.|..:.:.|.|  :...
Zfish   386 EVTEDSLGTYTCVPYNVLGTMGQSPPATLVLKDPPYFNVRPGGEYRQEAGRELVIPCAA--SGDP 448

  Fly   567 ERPTIKWQRQEGEQLTESQRNRIKISGGNITIENLRREDFGYYQCVVSNEVATLMAVTQLVIEGT 631
            |.|||:| |:.|:. :.|:.|  .:..|::...:|.:||.|.::||.:|.|.::.|.|:|.:.||
Zfish   449 EIPTIQW-RKVGKP-SRSKHN--LLPSGSLQFVSLSKEDHGEWECVATNVVTSITASTRLFVIGT 509

  Fly   632 QPHAPYNITGKATESSITLQWLPGYSGGSEYKQDYTIWF------REAGVNDWQTISVTPSGSTQ 690
            .||||.|:...|:.||..:.|.|||.||  ::|.:::|:      .:.|.:||.:|.| |.....
Zfish   510 SPHAPTNVHVSASTSSANVSWEPGYDGG--FEQTFSVWYGPVKVKNDVGTHDWLSIPV-PGSQMW 571

  Fly   691 VTINGLASGTTYEFQVVGRNVLGDGMMSKVMTVRTLEDAPAAPRNVKAATQPPDSFFQLMPDEAD 755
            :.:.||...|.|:|.|:.:|.||.|..|:|:||.|             ...|             
Zfish   572 LVVQGLEPKTAYQFSVLAQNKLGTGPFSEVVTVTT-------------GGYP------------- 610

  Fly   756 LLAYFDIYFHTDSRGTLVYSPPKLRVKGPKP----GPPRNVSVTEVSNGFLITWQSPLERAHIVK 816
                                     :..|:|    .|||.::......|.|:||..|......:.
Zfish   611 -------------------------ISTPEPLVLLTPPRCLTANRTQQGVLLTWLPPANHTSPID 650

  Fly   817 FYTIKYRTDAQWKTLNRGQIRPEETQYLVKNLVGGRTYYFRVLANSEKSYESSDEV-------KF 874
            .|.|::|...:|:.|: ..|...||:.:.::|:....|.||.||..:.....|..|       .|
Zfish   651 RYVIEFRLGEKWEVLD-DLIPATETEIIARDLIQDSWYEFRALAIMDDLVSESSNVVGVSSTDPF 714

  Fly   875 PVPARVKH----KAITAGVVGGILFFIVAIILSVCAVKICNKRKRRKQEKEFNMVACRITDARNI 935
            | |..:..    |.:.||:|..|.|...||:.|..|....||:.|||.:::.: ....||..|..
Zfish   715 P-PTEISDEGLAKPVVAGIVATICFLAAAILFSTLAACFVNKQHRRKLKRKRD-PPLSITHTRKS 777

  Fly   936 AANNHHL------------HNRS-------TGSISSGQVPLKKYKQTRISSLTAILIAILHWIWP 981
            ..:...|            .:||       :..:|||::..:....:|..||.::          
Zfish   778 IESPPPLTPLPGIEPYWEEPDRSSYRPPSTSPQLSSGKISPESIASSRPPSLASV---------- 832

  Fly   982 PDRCTNCHSIY----SSPNLED-----GDEDDGGGGRRRSVSR-----------IQRSLDGRFVL 1026
                 ..|.:|    .||..|.     .........::.|||:           |.|..|||||:
Zfish   833 -----GGHGLYVKKLPSPRKEKELSLYKKTKRAITSKKYSVSKHEAEVTTPIELISRGPDGRFVM 892

  Fly  1027 DVEGVSKLGYSQQTLESGNVD----VVDGGLF-ERRNSNVSQKSSSDDGGFLSRRNFITARASWR 1086
            |...:      ..:|:...::    |.:..|: |.|.|:    ..:||.|.|.            
Zfish   893 DPNDI------DSSLKPRRIEGFPFVEESDLYPEFRQSD----EENDDPGPLP------------ 935

  Fly  1087 RPLVASSSQLSLQSAADSARGFLQGLLKIGAKQSAVPPNSQSYFDEAVSGARYQNVLRPYTSSNN 1151
             |::|:                      :..:.|.|..:.:||........|:|           
Zfish   936 -PVMAT----------------------LRPQISPVSSSQESYMQPPAYSPRFQ----------- 966

  Fly  1152 LYGNADRSRPLHINTIS-GSLSQQQQLYTPSRISRIFSSSPQQLQPHHQQLLLSSGGSGAY---- 1211
                    ||:...:|| ||..|.......|...|:|...|          .....||||.    
Zfish   967 --------RPMEGMSISEGSRLQATGQSRVSHFHRVFPPGP----------FYGYIGSGAEVELH 1013

  Fly  1212 -PTHFSDLSTVYPPNSAERSSHNLSSRYRYYSQELPSLRTIQEETRRQQQQKQHPLEDHFVPLQL 1275
             |.:..|:|   |.:||..||.:       |..|.|.......|.|.:.:..|:....|.:|| :
Zfish  1014 PPFYMPDVS---PRSSAMSSSPS-------YPPEGPFRHPTIPEEREELRIHQYGASGHALPL-V 1067

  Fly  1276 PSPPSWRSY-------YQSQASYRPRTRWYPRHHSRLFSNRQQQHEMLSPLPQLNLNLRNSMNPG 1333
            .||||.||.       :.......||....|||.|.|      ..::..|.|.            
Zfish  1068 HSPPSSRSTEIWQPPDFPFLGQEGPRLALPPRHSSYL------HRDLPEPPPY------------ 1114

  Fly  1334 GLEASPESRSSSSGFGSKNTSNHPGSTSEWRL--------LPPYRAPPSPP--KHSGYFGGQQAQ 1388
                ...||:.|:      ||..|.|::..:|        ..|.|.||..|  ||   ...||||
Zfish  1115 ----PSHSRTVST------TSQLPSSSAFLQLEAPRTHLSRSPGRFPPQGPSAKH---ITMQQAQ 1166

  Fly  1389 --GQTPHGSYS-------YPRATT---PPYTMAH-------------WLEMISRLNAATDSNLPK 1428
              ||..|.::.       |..|||   .|.|: |             |:.             |:
Zfish  1167 TLGQLRHTAHGMGVPVLPYSGATTRMGSPSTL-HSESSDGWRSEAQPWMS-------------PR 1217

  Fly  1429 APCPVDVG---SVDGHYEFDPATPTPSAS---------------SMLREDLNLHIDTHPYHHHTL 1475
            |...:|:|   .|.......|.|.||.:|               |:||...:..:.....|..::
Zfish  1218 AARKMDLGLQQVVLQPSRLSPLTQTPPSSHAGSPDILVRPPPRPSILRSSRSQEMPESARHPASV 1282

  Fly  1476 GPLSGSLLHSHA--PYGG--GARKQRSLPAHL 1503
            .....||..|.|  |..|  |.|...|..||:
Zfish  1283 SFSRRSLSSSPATSPTQGQSGQRPSLSYRAHM 1314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 44/114 (39%)
IG_like 137..229 CDD:214653 36/93 (39%)
I-set 253..341 CDD:254352 29/88 (33%)
IGc2 268..331 CDD:197706 20/63 (32%)
I-set 346..437 CDD:254352 40/91 (44%)
Ig 349..437 CDD:299845 39/88 (44%)
Ig 459..530 CDD:299845 22/71 (31%)
IG_like 549..628 CDD:214653 24/79 (30%)
IGc2 551..617 CDD:197706 20/66 (30%)
FN3 633..725 CDD:238020 36/98 (37%)
FN3 786..874 CDD:238020 25/99 (25%)
igsf9baXP_009289969.2 IG 30..115 CDD:214652 36/95 (38%)
I-set 139..225 CDD:254352 29/88 (33%)
I-set 229..321 CDD:333254 40/92 (43%)
Ig 345..415 CDD:325142 22/70 (31%)
Ig 438..503 CDD:319273 22/71 (31%)
FN3 511..606 CDD:238020 36/98 (37%)
FN3 622..706 CDD:238020 24/85 (28%)
Atrophin-1 <924..1361 CDD:331285 115/516 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 443 1.000 Inparanoid score I1584
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D151368at33208
OrthoFinder 1 1.000 FOG0001378
OrthoInspector 1 1.000 T597115
orthoMCL 1 0.900 OOG5_132103
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.