DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and sdk1a

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:XP_009297968.1 Gene:sdk1a ZFINID:ZDB-GENE-081104-374 Length:2245 Species:Danio rerio

Alignment Length:1602 Identity:345/1603 (22%)
Similarity:554/1603 (35%) Gaps:462/1603 (29%)


  Fly   197 RVSRVSQDSPFGSASLNLT--NIRESDQGWYECKVVFLNRDPKQHKNGTWFHLDVHAPPRFSVTP 259
            |.:.|...|..||.|..||  |...:|.|.|.|:.:.|:...|..:...:  |.:...|.|:..|
Zfish   360 RRNGVEVASGVGSFSRRLTIINPTSTDVGMYVCEALLLDSSVKPAEARAF--LSI
TEAPYFTAEP 422

  Fly   260 EDIIYVNLGDSIILNCQADGTPTPEILWYKDANPVDP--SPTVGIFNDGTELRISTIRHEDIGEY 322
            ...:...:..|:.:.|||.|.|.|::.|||||.|:..  :|...|.: ...|::..::..|.|.:
Zfish   423 RRKMMGEVEKSVDIQCQARGVPMPKLEWYKDAVPLSKLNNPRYKIIS-SMGLQVRKLQPSDAGIF 486

  Fly   323 TCIARN--GEGQVSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNVTVRWYREGSP 385
            .|.|||  ||.|| ||...:.:.......||.:.|..:|....|:|.....|....| |.|:...
Zfish   487 QCFARNSAGEAQV-HTYLDV
TSMAPAFTAPPLDITVTDGAVAAFTCRVSGAPKPAIV-WRRDTQI 549

  Fly   386 VREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVEYPAKVTFTPTVQ 450
            :...:....|.|:.:.|.|.|.|:...|:|.|.|...|..| ..:|||.|:|.....::..||.:
Zfish   550 LASGSVQIPRFTLLESGGLQIQPVVLQDTGNYTCYAANSEG-AINASASLTVWSRTSISSPPTDR 613

  Fly   451 YLPFRLAGVVQCYIKSSPQ--LQYVTWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEHQGQYAC 513
            .:......:::|.....|:  ::|| |.||:.|:. :.....:.:..|||..::......|.|.|
Zfish   614 RVIKGTTAILECGATHDPRVGVRYV-WKKDEELVS-HSRGGRISLQEGSLHISQTWSGDIGNYTC 676

  Fly   514 TPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHCDALEAEGTERPTIKWQRQ-E 577
            ...:..|.......::| :..|.:    |..|..            :|.|..:....:.|.|. :
Zfish   677 DVISEAGNESKEARLEV-IELPHS----PRNLQA------------SLNANDSRSVDLSWMRPFD 724

  Fly   578 GE--------QLTESQR------NRIKISGGNITIENLR-REDFGYYQCVVSNEVATLMAVTQ-- 625
            |.        :|:|:..      :.:..||....::.|. ...:.:..|.| |:|......|:  
Zfish   725 GNSPLLHYVVELSENNSPWRVYLSDVDPSGTGAMVKGLTPARSYQFRVCAV-NQVGRGQYSTETN 788

  Fly   626 -LVIEGTQPHA-PYNITGKA-TESSITLQWLP-------GYSGGSEYKQDYTIWFREAGV-NDWQ 679
             |::....|.| |.||.... |..||.:||.|       |...|      |.:.:|.||: .::|
Zfish   789 RLMLREEPPSAPPKNIVASGRTNQSIMVQWQPPPEPQLNGVLRG------YVLRYRLAGLPGEYQ 847

  Fly   680 TISVTPSGSTQVTINGLASGTTYEFQVVGRNVLGDGMMSKVMTVRTLEDAPAAP------RNVKA 738
            ..:::........|..|...|.||.||......|.|:.|:.:|..||:..|.||      :.|.:
Zfish   848 QKNISSPEINYCLITELIIWTQYEIQVAAYTGAGLGVFSQPVTEYTLQGVPTAPPQGVEAKAVNS 912

  Fly   739 AT------QPPDSF-------FQLM------PDEADL------------LAY------FDIY--- 763
            .|      .||..|       ::||      |:|..:            |.|      |..|   
Zfish   913 TTIEFSWNPPPQQFINGINQGYKLMAWPERSPEEVIVVTITPDYHGTRHLGYISGLRKFSWYLTS 977

  Fly   764 ---FHTDSRGTLVYSPPKL-RVKGPKPGPPRNVSVTEVSNGFL-ITWQSPLERAHIVKFYTIKYR 823
               |.|...|.  .||||| :.....|||...:|.||:.:..| ::|:.|:::..|:..|.:   
Zfish   978 VLCFTTPGNGP--RSPPKLVQTFEDIPGPVGRLSFTEILDTSLKVSWEEPVDKNGIITGYLV--- 1037

  Fly   824 TDAQWKTLNRGQIRPEET------QYLVKNLVGGRTYYFRVLANSE--------KSYESSDEVKF 874
               .|:.....|.|....      .|.|..|....||...|.|.:|        .:..|....:.
Zfish  1038 ---SWEVQGNNQSRVARNLANTTLDYKVTGLTSLTTYTLEVAAMTEAGVGTVTSSTISSGVPPEL 1099

  Fly   875 PVP-------------ARVKHKA-----------ITAGVVGGILFFIVAIILSVCAVKICNKRKR 915
            |.|             |.:|.:|           |..|.||.|                 .:.:.
Zfish  1100 PGPPSNLVISKISSRSATLKFRAGDDGKTAISKWIVEGQVGSI-----------------GEDEE 1147

  Fly   916 RK--QEKEFNMVACRITDARNIAANNHHLHNRSTGSI---SSGQVPLKKYKQT------------ 963
            .|  .||| |....::.:..|:....|:.......:|   |:..|| .:..||            
Zfish  1148 WKVLYEKE-NDPEAQMLEVPNLTPFTHYRFRMRQVNIVGPSAVSVP-SRVIQTLQAPPDVAPSSV 1210

  Fly   964 --RISSLTAILIAILHWI-WPPDRCTNCHSIYSSPNLEDGDEDDGGGGRRRSV------------ 1013
              |.:|.|::      |: |.|           .|..|.....:..|.|.|.:            
Zfish  1211 TVRTASETSL------WLRWVP-----------LPESEYNGNPESVGYRVRVMRADLRGEASTRL 1258

  Fly  1014 --SRIQR--SLDG-----RFVLDVEGVSKLGYS--QQTLESGNVDVVDGGLFERRNSNVSQKSSS 1067
              .|::|  :|:|     .:.|.::..:.:|..  .::::....:.|..|..|  |......|||
Zfish  1259 LNDRLEREITLEGLEEWTEYQLQIQAFNSIGPGPWSESVKGRTRESVPSGAPE--NVTAEAMSSS 1321

  Fly  1068 -------------DDGGFLSRRNFITARASWRRPLVASSSQLSL------QSA-ADSARGFLQ-- 1110
                         .:|..|..:.....:.|      .|.:|:::      ||. ..:.|.::|  
Zfish  1322 RILVTWGPVPEHEQNGNILGYKVLFKEKDS------DSEAQVNVVKGNLTQSVLLRNLRKYVQYE 1380

  Fly  1111 ----GLLKIGAKQSAVPPNSQSYFDEA-----------VSGARYQNVLRPYTSSNNL---YGNA- 1156
                ...:||..|.:.||..:...|:.           |.....:.|.:|....|.:   |..| 
Zfish  1381 IQVLAFTRIGDGQLSNPPVLERTKDDVPGPPMRLVFPEVRLTEVRVVWQPPVDPNGIIMGYQVAY 1445

  Fly  1157 --DRSRPLHINTISGSLSQQQQLYTPSRIS-------RIFSSS---------------------- 1190
              |...|....||......:|  :|.|.::       ||.:.:                      
Zfish  1446 RLDSGDPNQFITIEVGPDTRQ--FTASSLTPESAYIFRISAKTEQGWGSPAQAVVITTEIRERPQ 1508

  Fly  1191 -PQQL---QPHHQ--QLLLS--SGGSGAYPTHFSDLSTVYPPNS-----AERSSHNLSS------ 1236
             |:||   |.|.|  :|||:  .||.|:.|..:..|.|...|:.     :...|||.||      
Zfish  1509 PPRQLRVPQDHVQSRKLLLNWVPGGDGSSPVRYFTLQTQELPSGEWITHSSAISHNYSSWEVDRL 1573

  Fly  1237 ----RYRY------------YSQELPSLRTIQ---EETRRQQQQKQHPLEDHFVPLQLPSPPS-- 1280
                .|:.            ||||..::.|:|   :|....|..|........|..|.|...|  
Zfish  1574 KPFTSYKLRMMATNDVGDSKYSQETDAITTLQDVPDEAPMIQSVKPSTTTSVLVQWQTPKEESVN 1638

  Fly  1281 -----WRSYYQSQASYRPRTRWYPRHHSRLFSNRQQQHEMLSPLPQLNLNLRNSMNPGGLEASPE 1340
                 :|.||                       |:.|::   ..||      :|..|..   |.:
Zfish  1639 GVLVGYRLYY-----------------------RELQYD---STPQ------DSKRPVN---SSQ 1668

  Fly  1341 SRSSSSGFGSKNTSNHPGSTSEWRL--LPPYR--------------APPSPPKHSGYFGGQQAQG 1389
            .|:..:...:..|.::| |.:|:.|  |..||              :|||.|..  .|.|:.|..
Zfish  1669 LRTELTAKSTVKTVSNP-SLTEFELTQLQKYRRYEIVMTAYNVIGESPPSAPVE--VFVGEAAPS 1730

  Fly  1390 QTPHGSYSYPRATTPPYTMAHWLEMISRLNAATDSNLPKAPCPVDV--GSVDG----HYEFDPAT 1448
            ..|...                  .|:.| ::|...:...|.|.:.  |.:.|    ::|.|...
Zfish  1731 VAPQNI------------------QINTL-SSTQLEVQWEPPPAETQNGIIQGYKILYWEMDSQN 1776

  Fly  1449 PTPSASSMLREDLNL---HIDTHPYHHHTL--------GPLS 1479
            .|.....:.|.:.|:   ::.::.|:...|        ||.|
Zfish  1777 ETERVKILFRPETNMRLKNLTSYTYYMVKLLAFNAAGDGPFS 1818

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 16/55 (29%)
IG_like 137..229 CDD:214653 13/34 (38%)
I-set 253..341 CDD:254352 31/92 (34%)
IGc2 268..331 CDD:197706 24/67 (36%)
I-set 346..437 CDD:254352 26/91 (29%)
Ig 349..437 CDD:299845 26/88 (30%)
Ig 459..530 CDD:299845 15/73 (21%)
IG_like 549..628 CDD:214653 16/98 (16%)
IGc2 551..617 CDD:197706 13/82 (16%)
FN3 633..725 CDD:238020 29/102 (28%)
FN3 786..874 CDD:238020 23/103 (22%)
sdk1aXP_009297968.1 I-set 125..208 CDD:254352
Ig 125..204 CDD:299845
IG_like 222..302 CDD:214653
Ig 236..287 CDD:299845
Ig_3 322..394 CDD:290638 13/34 (38%)
I-set 323..412 CDD:254352 16/54 (30%)
I-set 416..505 CDD:254352 31/91 (34%)
Ig 436..500 CDD:299845 25/66 (38%)
I-set 510..600 CDD:254352 26/92 (28%)
Ig 527..600 CDD:299845 22/75 (29%)
I-set 605..693 CDD:254352 17/90 (19%)
Ig 610..693 CDD:299845 17/85 (20%)
FN3 697..788 CDD:238020 18/108 (17%)
fn3 800..886 CDD:278470 25/92 (27%)
FN3 901..997 CDD:238020 22/98 (22%)
FN3 1002..1090 CDD:238020 22/94 (23%)
FN3 1100..1196 CDD:238020 21/115 (18%)
FN3 1206..1301 CDD:238020 17/112 (15%)
FN3 1308..1397 CDD:238020 18/97 (19%)
FN3 1408..1501 CDD:238020 15/95 (16%)
FN3 1507..1602 CDD:238020 26/95 (27%)
FN3 1616..1722 CDD:238020 28/144 (19%)
FN3 1732..1825 CDD:238020 18/107 (17%)
FN3 1830..1919 CDD:238020
FN3 1931..2021 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.