DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and lrit1b

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_001036218.1 Gene:lrit1b ZFINID:ZDB-GENE-060616-45 Length:654 Species:Danio rerio

Alignment Length:537 Identity:99/538 (18%)
Similarity:165/538 (31%) Gaps:231/538 (43%)


  Fly   247 LDVHAPPRFSVTPEDIIYVNLGDSIILNCQADGTPTPEIL--WYKDANPVD-------------- 295
            ||:|.....|:..|..:|:.....:.|:..:..|..||:|  |:....|:|              
Zfish   136 LDLHNNKISSIPAEATLYIRNLTYLDLSSNSLTTVPPEVLM
SWFSPKPPLDAEGSRMILGLHDNP 200

  Fly   296 ----------------PSPTVGIFNDGTELR------ISTIRHEDIGEYTC-IARNGEGQVSHTA 337
                            ||.:|...:.|  ||      :|.:...|.....| |.|      .|||
Zfish   201 WQCDCRLFDLVQFQKFPSSSVAFIDTG--LRCAEPESLSGVLFSDAELRRCQIPR------VHTA 257

  Fly   338 RVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNVTVRWYR-EGSPVREVAALETRVTIRKD 401
            ...:....             |..|:..|....:| ...:.|.| :|.|:......|    :.|:
Zfish   258 VARVRSSI-------------GNNVLLRCGTIGVP-IPELSWARADGKPMNGTVQQE----VSKE 304

  Fly   402 G---SLIINP-IKPDDSGQYLCEVTNGIGDPQSASAYLSV------------------------- 437
            |   |::..| :...|||:|:|:.||.:|   ||.|.:|:                         
Zfish   305 GIIWSILSVPAVSYRDSGKYVCKATNFVG---SADAIISLVISDTWQIDEAVAKRSHGKKSGGFG 366

  Fly   438 --EYPAKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEP---------YQMKDIV 491
              .|..|:    ..:|:|...:..|.                   ::||         .|::...
Zfish   367 RAAYQEKL----IARYVPPSTSAAVP-------------------IIEPLNSPQGSSSVQIESYS 408

  Fly   492 VMANGSLLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEM 556
            |.|:.|.|..:               .:.||            ||....||..| ||.|.:::|.
Zfish   409 VSADASKLKPK---------------PKPTA------------PPVGQTEPVAL-QRDVLNNLEP 445

  Fly   557 HCDALEAEGTERPTIKWQRQEGEQLTESQRNRIKISGGNITIENLRREDFGYYQCVVSNEVATLM 621
            :..:|: :|.||..::               .:|:.|.                           
Zfish   446 NASSLQ-QGPERRVVR---------------SVKVIGD--------------------------- 467

  Fly   622 AVTQLVIEGTQPHAPYNITGKATESSITLQW-LPGYSGGSEYKQDYTIWFREAGVNDWQTISVTP 685
                                  |:.:::|.| .|..:..:.:...|.::    |..|.:.|:|.|
Zfish   468 ----------------------TDHTVSLNWRAPTATNTTSFSVLYAVF----GERDMRRINVGP 506

  Fly   686 SGSTQVTINGLASGTTY 702
             |..::||.||...|.|
Zfish   507 -GKNRITIEGLVPKTKY 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 2/3 (67%)
IG_like 137..229 CDD:214653
I-set 253..341 CDD:254352 25/127 (20%)
IGc2 268..331 CDD:197706 19/102 (19%)
I-set 346..437 CDD:254352 25/96 (26%)
Ig 349..437 CDD:299845 25/93 (27%)
Ig 459..530 CDD:299845 10/80 (13%)
IG_like 549..628 CDD:214653 8/79 (10%)
IGc2 551..617 CDD:197706 7/66 (11%)
FN3 633..725 CDD:238020 17/72 (24%)
FN3 786..874 CDD:238020
lrit1bNP_001036218.1 LRR_RI <59..168 CDD:238064 7/32 (22%)
leucine-rich repeat 64..84 CDD:275380
LRR_8 83..143 CDD:290566 3/7 (43%)
leucine-rich repeat 85..108 CDD:275380
leucine-rich repeat 109..132 CDD:275380
LRR_8 131..>176 CDD:290566 11/40 (28%)
LRR_4 131..172 CDD:289563 8/36 (22%)
leucine-rich repeat 133..156 CDD:275380 6/20 (30%)
leucine-rich repeat 157..175 CDD:275380 4/18 (22%)
leucine-rich repeat 185..203 CDD:275378 1/18 (6%)
LRRCT 199..243 CDD:214507 7/46 (15%)
I-set 252..343 CDD:254352 29/118 (25%)
IGc2 265..333 CDD:197706 20/86 (23%)
FN3 459..526 CDD:214495 19/134 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.