DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and dpr19

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster

Alignment Length:384 Identity:83/385 (22%)
Similarity:136/385 (35%) Gaps:108/385 (28%)


  Fly   318 DIGEYTCIARNGEG-------QVSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNV 375
            |:|:.|. ::|..|       ...:..|||...|.:.::|               |..| :....
  Fly    23 DVGKITS-SQNHFGNTLQSQFNTKNNTRVIAQKGGLAILP---------------CVVK-VNSPA 70

  Fly   376 TVRWYREGSPVREVAALETRVTIRK----------DGSLIINPIKPDDSGQYLCEVTNGIGDPQS 430
            ||.|.|..........|.|..:.::          ..||.|..::.:|.|.|.|:::  |...||
  Fly    71 TVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLS--IYPTQS 133

  Fly   431 ASAYLS-VEYPAKVTFTPTV---QYLPFRLAGVVQCYIK-SSPQLQYVTWTKDKRLLEPYQMKDI 490
            ....|. ||..|:::..|.:   :....||    :|.:| ::....:|.|..|.:::. |.    
  Fly   134 IVIELKIVEAVAEISSAPELHIDETSTLRL----ECKLKRATENPAFVFWYHDSKMIN-YD---- 189

  Fly   491 VVMANGSLLFTRVNEEH--QGQ-YACTPYNAQGTA----GASGVMDVLVR-----KPPAFTVEPE 543
               :.|..:.|.:.:.:  .|| |..:|.|.....    .::||::.|:.     |.||..|...
  Fly   190 ---SQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSS 251

  Fly   544 TLYQRKVGDSVEMHCDALEAEGTERPTIKWQRQEGEQLTESQRNRIKISGGNITIENLRREDFGY 608
            |.|..:                        |.|....|..|    :.:    :|::.:.....|.
  Fly   252 TPYMTQ------------------------QHQSAYLLNPS----VSV----LTVKQVNFRHAGN 284

  Fly   609 YQCVVSNEVATLMAVTQLVIEG----TQPHAPYNI-----TGKATESSITLQWLPGYSG 658
            |.|..||  |...::|..|:.|    ...||..:|     .|..|...|||..|.|.||
  Fly   285 YTCAPSN--ARPASITVHVLRGEKTAAMQHANRSILDTETNGNGTFGLITLGGLNGTSG 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989
IG_like 137..229 CDD:214653
I-set 253..341 CDD:254352 8/30 (27%)
IGc2 268..331 CDD:197706 4/13 (31%)
I-set 346..437 CDD:254352 20/102 (20%)
Ig 349..437 CDD:299845 20/99 (20%)
Ig 459..530 CDD:299845 15/79 (19%)
IG_like 549..628 CDD:214653 13/79 (16%)
IGc2 551..617 CDD:197706 10/66 (15%)
FN3 633..725 CDD:238020 12/32 (38%)
FN3 786..874 CDD:238020
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 19/93 (20%)
IGc2 55..125 CDD:197706 17/86 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.