DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and bdl

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster

Alignment Length:826 Identity:252/827 (30%)
Similarity:390/827 (47%) Gaps:158/827 (19%)


  Fly    94 VPIRRGQGSTPTPTIQVLQFVLVSLLA-LLAKNAQAHNIPED---AVHITAILGEGVIFNCHVEF 154
            :|.:|.:      |.:.....|::||| :|..|....:...|   ..::.|.:|..|:|||:::|
  Fly     1 MPAKRSR------TFRQSGSALLALLAIILLMNISCTSAARDHRRQTNLEAKVGSHVVFNCYIDF 59

  Fly   155 PNDHPVPYVLQWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRE 219
            |.|.|:||::.|.|      .:..|:.|||. .....|.:.||:..|.....||.||:|||.|||
  Fly    60 PFDAPIPYLVHWTK------DNKKIFTWYEQ-ETSTSELFNGRLHLVENHPEFGRASVNLTAIRE 117

  Fly   220 SDQGWYECKVVFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNCQADGTPTPE 284
            ||||||.|:|.|.||.|....|||.:||.|.                                  
  Fly   118 SDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQ---------------------------------- 148

  Fly   285 ILWYKDANPVDPSPTVGIFNDGTELRISTIRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMV 349
                                                                      ||::|.:
  Fly   149 ----------------------------------------------------------GGSLIRI 155

  Fly   350 PPTNQTKLEGEKVIFSCEAKAMPGNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDS 414
            ||.|||..||:...|.|..| .|.|....||::|..::||..|..|..:..||||.|:|....|.
  Fly   156 PPVNQTIREGQTAFFHCVMK-HPENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDL 219

  Fly   415 GQYLCEVTNGIGDPQSASAYLSVEYPAKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDK 479
            |:|.|:|.|..|:.|:|.|:|:::|.|||.:.|...:||:....|:.|:.:::|.|:.:.|.||.
  Fly   220 GEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRWEKDG 284

  Fly   480 RLLEPYQMKDIVVMANGSLLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPET 544
            .|.:.|.:..:....||||.|.:|:|.|.|.|.|||||..||.|.|.|:.|:|.:||.|:|.|:.
  Fly   285 LLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPKA 349

  Fly   545 LYQRKVGDSVEMHCDALEAEGTERPTIKWQRQEGEQLTESQRNRIKISGGNITIENLRREDFGYY 609
            :|.:|:|::.|:.|:|::.:|..||:|.|.|::|:.|   ..:|..:||||:||..|...|.|.|
  Fly   350 IYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPL---PADRFSLSGGNLTITGLVEGDRGIY 411

  Fly   610 QCVVSNEVATLMAVTQLVIEGTQPHAPYNITGKATESSITLQWLPGYSGGSEYKQDYTIWFREAG 674
            :|..:||.||:.|..:|:||...|.||||:|..:||:.||::|.|||   .....:||:|:|...
  Fly   412 ECSATNEAATITAEAELMIENIAPRAPYNLTANSTETCITIRWQPGY---LRPNLEYTVWYRLME 473

  Fly   675 VNDWQTISVTPSGSTQVTINGLASGTTYEFQVVGRNVLGDGMMSKVMTVRTLEDAPAAPRNVKAA 739
            ..:|:|:.|......:.|:..|..|..|||.|:.::..||||.||....:||      |..::| 
  Fly   474 APEWRTLRVLDKKVMEATVQHLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTL------PSPIRA- 531

  Fly   740 TQPPDSFFQLMPDEADLLAYFDIYFHTDSRGTLVYSPPKLRVKGPKPGPPRNVSVTEVSNGFLIT 804
                |.|      :|..|.: |:...|...|.|              |.|.|::......|:|:.
  Fly   532 ----DDF------DAQQLQH-DLGQVTAPAGGL--------------GAPWNLTAISNQQGWLLH 571

  Fly   805 WQSPLERAHIVKFYTIKYRTDAQWKTLNRGQIRPEET---QYLVKNLVGGRTYYFRVLANSEKSY 866
            |:.|::....::.|.:::     ||......|...||   .|.:::|.....:..:|||...::.
  Fly   572 WEHPVQGLEGLRLYAVRW-----WKEPEHFLIGHAETFDNYYQLRHLKEDTLFKVQVLAVGTETQ 631

  Fly   867 ES--SDEVKFPVPARVKHKAITAGVVGGILFFIVAIILSVCAVKIC 910
            :|  |.|:...||::.|.:|:..|...|::|.:.|:...:...:.|
  Fly   632 QSVPSHELLIDVPSQRKVRALIIGSSVGVIFLLCALCAFLYVKRSC 677

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 50/113 (44%)
IG_like 137..229 CDD:214653 39/92 (42%)
I-set 253..341 CDD:254352 0/88 (0%)
IGc2 268..331 CDD:197706 0/63 (0%)
I-set 346..437 CDD:254352 37/91 (41%)
Ig 349..437 CDD:299845 36/88 (41%)
Ig 459..530 CDD:299845 29/71 (41%)
IG_like 549..628 CDD:214653 31/79 (39%)
IGc2 551..617 CDD:197706 26/66 (39%)
FN3 633..725 CDD:238020 34/92 (37%)
FN3 786..874 CDD:238020 21/93 (23%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 40/93 (43%)
Ig 43..131 CDD:299845 41/95 (43%)
I-set 153..242 CDD:254352 37/90 (41%)
Ig 157..242 CDD:299845 35/86 (41%)
Ig_2 252..337 CDD:290606 33/85 (39%)
IG_like 260..327 CDD:214653 26/67 (39%)
I-set 341..428 CDD:254352 35/90 (39%)
IGc2 356..419 CDD:197706 26/66 (39%)
FN3 435..524 CDD:238020 34/92 (37%)
FN3 554..636 CDD:238020 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D151368at33208
OrthoFinder 1 1.000 FOG0001378
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10075
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.