DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and itgb4

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:XP_005166847.1 Gene:itgb4 ZFINID:ZDB-GENE-030131-7209 Length:1931 Species:Danio rerio

Alignment Length:599 Identity:123/600 (21%)
Similarity:203/600 (34%) Gaps:200/600 (33%)


  Fly   367 EAKAMPGNVTVRWYREGSPVRE----VAALETRVTI-RKDGSLIINPIKPDDSGQYLCEVTN-GI 425
            :.|.:||..||...:|.:...|    |.:::.||.: .||        :.|:..:.|.:..: .:
Zfish   914 DLKVIPGYYTVASDKEAAGAVEFPENVESVDVRVPLFIKD--------EDDEKKELLVQAVDVPV 970

  Fly   426 GDPQSASAYLSV---EYPAKVTFT---PTVQYLPFRLAGVVQCYIK------SSPQLQYVT---W 475
            |..:....::::   :..|...||   |:..|  .|..||....||      ...|:.|.|   .
Zfish   971 GIAKIGKDHVNITVLKEQASSVFTFLEPSYTY--SRQDGVANIPIKRQIIEDGRAQVTYSTADLT 1033

  Fly   476 TKDKR--------------------------------LLEPYQMKDIVVMANGSLLFTRVNEEHQ 508
            .|||:                                |||..|:|..|:.........::     
Zfish  1034 AKDKKDYISVDGDLSYGAGETEKIVPVKLLELGEQDGLLEDKQVKQFVMDLTNPRQSAKL----- 1093

  Fly   509 GQYACTPYNAQGTAGASGVMDVLVRKPP----AFTVEPETLYQRKVGDSVEMHCDALEAEGT-ER 568
            |:|..|             :..:..||.    ||....:|.   ...||  ::...:|..|. |.
Zfish  1094 GRYPRT-------------VITIADKPESSVMAFKKSTQTF---STTDS--LYTIPVERTGNRET 1140

  Fly   569 P-TIKWQRQEGEQLTESQRNRIKISGG----NITIE-------------NLRREDFGYYQCVVSN 615
            | |:.|:..:..:...|  :.:|.:.|    ||.|.             ||...| .....::..
Zfish  1141 PATVHWRTNKASRFDIS--SPLKFAPGEAEKNILINPRTHPSPIIPEKFNLELLD-PSNNAIIGK 1202

  Fly   616 EVATLMAVTQ---------------LVIEGTQP----HAPYNITGKAT-ESSITLQWLPGYSGGS 660
            ...|.:.||.               :....|.|    ::|.||...|| ..:|.|.|.|..:...
Zfish  1203 RKTTEVIVTDGRGDGKNQDFQKMEYVTQTATSPGGRLYSPANIKAVATGPKNIRLNWKPSQNANG 1267

  Fly   661 EYKQDYTIWFREAGVNDWQTISVTPSGSTQVTINGLASGTTYEFQVVGRNVLGDGMMSKVMTVRT 725
             ||..|.|:........:..:. ||    |..:..|.....||.:|.|.|.||||..|.::..:|
Zfish  1268 -YKVKYWIYGDPEDKAKFMDVK-TP----QAELTNLDPYCDYEMRVCGYNALGDGNYSDIIQCQT 1326

  Fly   726 LEDAPAAPR----NVKAATQPPDSFFQLMPDEAD-LLAYFDIYFHTDSRGTLVYSPPKLRVKGPK 785
            |||.|..|.    ||.:.|....|:.:  |.||: ::..:::          :|.|..   :..|
Zfish  1327 LEDIPGEPGRLAFNVISPTVTQVSWAE--PAEANGIITGYEV----------IYMPIN---EDKK 1376

  Fly   786 P-GPPRNVSVTEVSNGFLITWQSPLERAHIVKFYTIKYRTDAQWKTLNRGQIRPEETQYLVKNLV 849
            | |||:.|.:.                                         .|::...|::||.
Zfish  1377 PTGPPKKVMID-----------------------------------------NPKKRMLLIENLQ 1400

  Fly   850 GGRTYYFRVLANSE 863
            ..:||.::|.|:::
Zfish  1401 PSQTYCYKVRASNK 1414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989
IG_like 137..229 CDD:214653
I-set 253..341 CDD:254352
IGc2 268..331 CDD:197706
I-set 346..437 CDD:254352 15/76 (20%)
Ig 349..437 CDD:299845 15/76 (20%)
Ig 459..530 CDD:299845 18/112 (16%)
IG_like 549..628 CDD:214653 20/113 (18%)
IGc2 551..617 CDD:197706 17/85 (20%)
FN3 633..725 CDD:238020 28/97 (29%)
FN3 786..874 CDD:238020 13/80 (16%)
itgb4XP_005166847.1 Integrin_beta 37..457 CDD:278776
EGF_2 <468..490 CDD:285248
EGF_2 545..573 CDD:285248
Integrin_B_tail 625..709 CDD:285239
Calx-beta 991..1064 CDD:295344 15/75 (20%)
FN3 1242..1326 CDD:238020 27/90 (30%)
FN3 1331..1420 CDD:238020 25/141 (18%)
fn3 1640..1720 CDD:278470
fn3 1751..1835 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.