DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and dpr2

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster

Alignment Length:292 Identity:69/293 (24%)
Similarity:101/293 (34%) Gaps:82/293 (28%)


  Fly   137 HITAILGEGVIFNCHVEFPNDHPVPYVLQWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRV 201
            :||...|.....||.|:...|..|.::.:.|..:...|     .:.|.|     :|.:|  |.|.
  Fly   115 NITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAG-----ILTYTS-----DERFK--VVRT 167

  Fly   202 SQDSPFGSASLNLTNIRESDQGWYECKVVFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDI---- 262
            :....:   :|::...:..|.|.|||:|   |.:|   |....|.|:|      .|||.|.    
  Fly   168 ADSKDW---TLHVKYAQPRDSGIYECQV---NTEP---KISMAFRLNV------IVTPPDAKAII 217

  Fly   263 -----IYVNLGDSIILNCQADGTPTP-----EILWYKDANPVDPSPTVGIFNDG----------- 306
                 :||.:|.|:.|.|......|.     .|.||:  .|...:|.|...||.           
  Fly   218 AGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYR--GPYILTPFVAHPNDAAIDLQRISMES 280

  Fly   307 -------TELRISTIRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMV----PPTNQTKLEGE 360
                   :.|||:..:..|.|.|||:....|           |...|:.|    .|....|....
  Fly   281 TLAEKLQSRLRIANAQLLDTGNYTCMPTTAE-----------AASVVVNVINDESPAAMQKSRAI 334

  Fly   361 KVIFSCEAK------AMPGNVTVRWYREGSPV 386
            :...|..:.      ||..:..|||...|..:
  Fly   335 RTSGSMRSSRLVLLLAMVASSVVRWLIGGQRI 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 29/113 (26%)
IG_like 137..229 CDD:214653 22/92 (24%)
I-set 253..341 CDD:254352 28/120 (23%)
IGc2 268..331 CDD:197706 22/86 (26%)
I-set 346..437 CDD:254352 11/52 (21%)
Ig 349..437 CDD:299845 10/49 (20%)
Ig 459..530 CDD:299845
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 28/112 (25%)
Ig 116..192 CDD:299845 22/91 (24%)
ig 220..306 CDD:278476 23/88 (26%)
IG_like 220..306 CDD:214653 23/88 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.