DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and Bsg

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_723346.2 Gene:Bsg FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster

Alignment Length:499 Identity:95/500 (19%)
Similarity:151/500 (30%) Gaps:190/500 (38%)


  Fly   167 DKKVSETGSDLPIYIWYESYPEHIE---EGYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECK 228
            |:....:..|.....|.|...:..:   :.:|...|.:.    :|:|||:      ..|.|:   
  Fly   155 DELTPNSADDFFTRAWLEQQQQQQQLPHQSHKLHKSHLG----YGNASLS------GSQPWH--- 206

  Fly   229 VVFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNCQADGTPTPEILWYKDANP 293
                   |.....|      :|..  :|.||.|.....|.    |..|....|.|..:.|   ||
  Fly   207 -------PSAGGGG------IHRV--YSATPPDFPPPRLN----LLEQTVAPPEPPTILY---NP 249

  Fly   294 VDPSPTVGIFNDGTELRISTIRHE----------------------------------------- 317
            ....||.......|.:.::|..|.                                         
  Fly   250 NPTHPTASATATETSVLLTTAHHHAHHQQQLQQQSQHTLNAFQLPLPPRPNPGQNERYQTYAPHY 314

  Fly   318 --------------------DIGEYTCIA--------RNGEGQVS-------HTARVIIAGGAVI 347
                                ..||.|.|:        ..|.|.|:       .:..::.|||.::
  Fly   315 VPPVVVSGAGAGAGADPGAGASGEQTTISAATSTRAMMGGGGGVAGAGFSAGASGPMLGAGGHML 379

  Fly   348 MVPPTNQTKLEGE----------------------------KVIFSCEAK-AMPGNVTVRWYREG 383
            |....:|..|:.:                            .::.||..| ..||.|.: |.:.|
  Fly   380 MGGQGHQVHLQHQTLLPVKMDKLVPNYDNAEHQMKFYDIRSPLVLSCNVKDGTPGGVLI-WKKNG 443

  Fly   384 SPVREVAALETRV-TIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVEYPA------ 441
            :.|.:|.:|..|. .|..:...||:....:|.|:|.||. :|:.......|.:.|..|:      
  Fly   444 TAVTDVPSLRGRFKLIADENKFIIDKTDTNDDGKYSCEF-DGVSKEIEVIARVVVRVPSNTAVVE 507

  Fly   442 --KVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWT---------KDKRLLEPYQMKDIVVMAN 495
              |::.|.:|              :.:.|:|   |||         .|:.:|:|    |...:.|
  Fly   508 GEKMSVTCSV--------------VGTKPEL---TWTFANVTLTNATDRFILKP----DDNGVPN 551

  Fly   496 GSLLFTRVNEEHQGQYACTPYNAQGTAG------ASGVMDVLVR 533
            ..|....|..:.:|:|.|...||....|      ||.|..|.|:
  Fly   552 AILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPASDVTTVRVK 595

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 14/86 (16%)
IG_like 137..229 CDD:214653 12/65 (18%)
I-set 253..341 CDD:254352 24/164 (15%)
IGc2 268..331 CDD:197706 17/132 (13%)
I-set 346..437 CDD:254352 25/121 (21%)
Ig 349..437 CDD:299845 24/118 (20%)
Ig 459..530 CDD:299845 21/86 (24%)
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
BsgNP_723346.2 IG_like 420..497 CDD:214653 22/79 (28%)
Ig 423..497 CDD:299845 22/76 (29%)
IG_like 500..583 CDD:214653 22/104 (21%)
Ig 512..575 CDD:143165 19/84 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10075
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.