DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and Kirrel3

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:XP_017451106.1 Gene:Kirrel3 RGDID:1311382 Length:784 Species:Rattus norvegicus

Alignment Length:915 Identity:191/916 (21%)
Similarity:307/916 (34%) Gaps:271/916 (30%)


  Fly   132 PEDAVHITAILGEGVIFNCHV-EFPNDHPVPYVLQW--DKKVSETGSDLPIYIWYESYPEHIEEG 193
            |:|.|   .:.|:.|...|.: |:..     :|| |  |......|.||      .|||:::..|
  Rat    60 PQDQV---VVSGQPVTLLCAIPEYDG-----FVL-WIKDGLALGVGRDL------SSYPQYLVVG 109

  Fly   194 YKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKVV---FLNRDPKQHKNGTWFHLDVHAPPRF 255
                 :.:|     |...|.:......|...|||:.:   ..:|                 |.|.
  Rat   110 -----NHLS-----GEHHLKILRAELQDDAVYECQAIQAAIRSR-----------------PARL 147

  Fly   256 S--VTPED-------IIYVNLGDSIILNCQADGT-PTPEILWYKDANPVDPSP-TVGIFNDG-TE 308
            :  |.|:|       :|.:..||.:.|.|.||.. |...|:|.:....::.:. :..:..|| .|
  Rat   148 TVLVPPDDPIILGGPVISLRAGDPLNLTCHADNAKPAASIIWLRKGEVINGATYSKTLLRDGKRE 212

  Fly   309 LRIST--IRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMV------PP------TNQTKLEG 359
            ..:||  |...|:       .||:..|.......|.||....|      ||      ..|..||.
  Rat   213 SIVSTLFISPGDV-------ENGQSIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPVLED 270

  Fly   360 EKVIFSCEAKAMPGNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNG 424
            ..|.|.|.|||.|.....||.:.|..::|.:....|.|:  |.:....|:.        |||||.
  Rat   271 NIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTV--DYTYFSEPVS--------CEVTNA 325

  Fly   425 IGDPQSASAYLSVEYPAKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKD 489
            :|. .:.|..:.|.:..::|..|....:......|..|....:|.|. :.|.|        :...
  Rat   326 LGS-TNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLT-IVWMK--------RGSG 380

  Fly   490 IVVMANGSLLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKV-GDS 553
            :|:....:|....|.:|..|:|.|.....:..||...| .:.|..||..:   .|..|..: |:.
  Rat   381 VVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREV-TLTVNGPPIIS---STQTQHALHGEK 441

  Fly   554 VEMHCDALEAEGTERPTIKWQRQEGEQLTESQRNRIKISGGNITIENLRREDFGYYQCVVSNEVA 618
            .::.|........:|....|:    |.:.||.      :.|..|:|.:..|:.......:||.| 
  Rat   442 GQIKCFIRSTPPPDRIAWSWK----ENVLESG------TSGRYTVETVNTEEGVISTLTISNIV- 495

  Fly   619 TLMAVTQLVIEGTQPHAPYNITGKATESSITLQWLPGYSGGSEYKQDYTIWFREAGVNDWQTISV 683
              .|..|.:...|    .:|..|..|| .|.|:     ..|||.|..       ||:   :..||
  Rat   496 --RADFQTIYNCT----AWNSFGSDTE-IIRLK-----EQGSEMKSG-------AGL---EAESV 538

  Fly   684 TPSGSTQVTINGLASGTTYEFQVV------------GRNVLGDGMMSKVMTVRTLEDAPAAPRNV 736
                 ....|.|:|.|....|.|:            .||:.|.......:.|..:...||:.|..
  Rat   539 -----PMAVIIGVAVGAGVAFLVLMATIVAFCCARSQRNLKGVVSAKNDIRVEIVHKEPASGREA 598

  Fly   737 KAATQPPDSFFQLMPDEADLLAYFDIYFHTDSRGTLVYSPPKLRVKGPKPGPPRNVSVTEVSNGF 801
            :..|    :..|||.|..:        |..|                                  
  Rat   599 EDHT----TIKQLMMDRGE--------FQQD---------------------------------- 617

  Fly   802 LITWQSPLERAHIVKFYTIKYRTDAQWKTLNRGQIRPEETQYLVKNLVGGRTYYFRVLANSEKSY 866
                 |.|::..::|                     .||.::  :||......|:.|  |:.|.:
  Rat   618 -----SVLKQLEVLK---------------------EEEKEF--QNLKDPTNGYYSV--NTFKEH 652

  Fly   867 ESSDEV-------------KFPVPARVKHKAITAGVVG-GILF-----FIVAIILSVCAVKICNK 912
            .|:..:             |..||..:....|.:.:.| |.|:     |::.  :...::::|.:
  Rat   653 HSTPTISLSSCQPDLRPTGKQRVPTGMSFTNIYSTLSGQGRLYDYGQRFVLG--MGSSSIELCER 715

  Fly   913 RKRR---KQEKEFNMVAC--------------RITDARNIAANNHHLHNRSTGSISSGQVPLKKY 960
            ..:|   .....|....|              :...|...:|::.| |::|:...|....||::.
  Rat   716 EFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSH-HSQSSSQNSDPSRPLQRR 779

  Fly   961 KQTRI 965
            .||.:
  Rat   780 MQTHV 784

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 23/119 (19%)
IG_like 137..229 CDD:214653 22/95 (23%)
I-set 253..341 CDD:254352 24/102 (24%)
IGc2 268..331 CDD:197706 18/68 (26%)
I-set 346..437 CDD:254352 28/103 (27%)
Ig 349..437 CDD:299845 28/100 (28%)
Ig 459..530 CDD:299845 16/71 (23%)
IG_like 549..628 CDD:214653 16/80 (20%)
IGc2 551..617 CDD:197706 13/66 (20%)
FN3 633..725 CDD:238020 24/104 (23%)
FN3 786..874 CDD:238020 13/101 (13%)
Kirrel3XP_017451106.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.