DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and Mdga1

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:XP_006256269.1 Gene:Mdga1 RGDID:1307031 Length:956 Species:Rattus norvegicus

Alignment Length:846 Identity:197/847 (23%)
Similarity:304/847 (36%) Gaps:166/847 (20%)


  Fly    62 TLTASPA-----KTAAFTVKTTRRRRSRRRAEGSSICVPIRRGQGSTPTPTIQVLQFVLVSLLAL 121
            |.||..|     :|:.|. :|.|..|..|...|...|    :.:.....|.|:.::.        
  Rat    73 TKTAGSASDKFQETSVFN-ETLRIERIARTQGGRYYC----KAENGVGVPAIKSIRV-------- 124

  Fly   122 LAKNAQAHNIPEDAVHITAILGEG-------VIFNCHVEFPNDHPVPYVLQWDKKVSET------ 173
               :.|..:.|...||.|.....|       |...|.|.  ::.|..::  | |:.|:|      
  Rat   125 ---DVQYLDEPVLTVHQTVSDVRGNFYQEKTVFLRCTVS--SNPPARFI--W-KRGSDTLSHSQD 181

  Fly   174 -GSDL--PIYIWYESYPEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKVVFLNRD 235
             |.|:  |:|...|                        :..|.|.|:|..|...|.|:|...|..
  Rat   182 NGVDIYEPLYTQGE------------------------TKVLKLKNLRPQDYASYTCQVSVRNVC 222

  Fly   236 PKQHKNGTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNC-QADGTPTPEILWYKDANPVDPSPT 299
            ....|:.|:...:..|||...::..:.:.||.|:::.:.| ...|.|.|::.|.....|:    .
  Rat   223 GIPDKSITFQLTNTTAPPTLKLSVNETLVVNPGENVTVQCLLTGGDPLPQLHWSHGPGPL----P 283

  Fly   300 VGIFNDGTELRISTIRHEDIGEYTCIARNGEGQ-VSHTARVIIAG--GAVIMVPPTNQTKLE--- 358
            :|....|..|.|.:::..|.|.|.|.|.|..|. ...|..:::..  .|...:.|....:.|   
  Rat   284 LGALAQGGTLSIPSVQARDSGYYNCTATNNVGNPAKKTVNLLVRSLKNATFQITPDMIKESENIQ 348

  Fly   359 -GEKVIFSCEAKAMP-GNVTVRWYREGSPVREVAALETRVTIRKD-------GSLIINPIKPDDS 414
             |:.:..||...|:| ..|..:|::.|.|.|....|   :..|.|       .||.:..:...|.
  Rat   349 LGQDLKLSCHVDAVPQEKVNYQWFKNGKPARTSKRL---LVTRNDPELPAVTSSLELIDLHFSDY 410

  Fly   415 GQYLCEVTNGIGDPQSASAYLSVEYP-AKVTFTPTVQYLPFRLAGVV--------QCYIKSSPQL 470
            |.|||..:    .|.|....||||.. :..|..||:.....|....|        ||.::..|: 
  Rat   411 GTYLCVAS----FPGSPVPDLSVEVNISSETVPPTISVPKGRAVVTVREGSPAELQCEVRGKPR- 470

  Fly   471 QYVTWTK-DKR-LLEPYQMKDIVVMANGSLLFTRVNEEHQGQYAC--TPYNAQGTAGASGVMDVL 531
            ..|.|:: ||. .|.|..:. :....:|.|...||:.|..|.|.|  ..||..........:.:.
  Rat   471 PPVLWSRVDKEAALLPSGLA-LEETPDGKLRVERVSREMSGTYRCQTARYNGFNVRAREAQVQLT 534

  Fly   532 VRKPPAFTVEPETLYQRK-VGDSVEMHCDALEAEGTERPTIKWQRQEGEQLTESQRNRIKISGG- 594
            |..||  .|||.:...|: :|..|.:.|..|........:..| |.:|:.|..........:.| 
  Rat   535 VHFPP--EVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVW-RFKGQLLPPPPVLPAAAAEGP 596

  Fly   595 ---NITIENLRREDFGYYQCVVSNEVATLMAVTQLVIEGTQPHAPYNITGKATES-------SIT 649
               .:.::.|.|:..|.|:|.|||:|.:...:.|:..:...|.. |..|...|.|       |..
  Rat   597 DHAELRLDALTRDSSGNYECSVSNDVGSATCLFQVSAKAYSPEF-YFDTPNPTRSHKLSKNYSYV 660

  Fly   650 LQWLPGYSGGSEYKQDYTIWFRE-----AGVNDWQTISVTPSGSTQVTINGLASGTTYEFQVVGR 709
            |||........:...:|.:..|:     |.|.......|......:.|:..|....:||..:...
  Rat   661 LQWTQREPDAVDPVLNYRLSIRQLNQHNAMVKAIPVRRVEKGQLLEYTLTDLRVPHSYEIHLTPY 725

  Fly   710 NVLGDG-MMSKVMTVRTLEDAPAAPRNVKAATQPPDSFFQLMPDE------ADLLAYFDIYFHTD 767
            ...|.| |.|:|:......::|:...|.        ..|:   ||      .||...||.     
  Rat   726 TTFGAGDMASRVIHYTEPINSPSLSDNT--------CHFE---DEKICGYTQDLTDNFDW----- 774

  Fly   768 SRGTLVYSPPKLRVKGPKPGPPRNVSVTEVSNGFLITWQSPLE---RAHIV--------KFYTIK 821
            :|...:...||   :.|..|||.::|.|.......|....|.|   ||.:|        |||.:.
  Rat   775 TRQNALTQNPK---RSPNTGPPTDISGTPEGYYMFIETSRPRELGDRARLVSPLYNASAKFYCVS 836

  Fly   822 Y 822
            :
  Rat   837 F 837

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 27/129 (21%)
IG_like 137..229 CDD:214653 23/108 (21%)
I-set 253..341 CDD:254352 22/90 (24%)
IGc2 268..331 CDD:197706 17/64 (27%)
I-set 346..437 CDD:254352 26/103 (25%)
Ig 349..437 CDD:299845 26/100 (26%)
Ig 459..530 CDD:299845 20/83 (24%)
IG_like 549..628 CDD:214653 19/84 (23%)
IGc2 551..617 CDD:197706 17/70 (24%)
FN3 633..725 CDD:238020 23/105 (22%)
FN3 786..874 CDD:238020 14/49 (29%)
Mdga1XP_006256269.1 IG_like 46..126 CDD:214653 14/69 (20%)
Ig 56..115 CDD:299845 12/47 (26%)
IG_like 152..217 CDD:214653 21/94 (22%)
Ig 153..217 CDD:143165 21/93 (23%)
IG_like 248..326 CDD:214653 21/82 (26%)
IGc2 254..315 CDD:197706 17/65 (26%)
IGc2 350..418 CDD:197706 20/71 (28%)
IG_like 450..535 CDD:214653 20/87 (23%)
Ig 459..535 CDD:299845 19/78 (24%)
Ig 541..623 CDD:299845 22/83 (27%)
IG_like 543..632 CDD:214653 21/90 (23%)
MAM 754..918 CDD:279023 25/96 (26%)
MAM 754..917 CDD:99706 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.