DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and MDGA1

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:XP_006715119.1 Gene:MDGA1 HGNCID:19267 Length:973 Species:Homo sapiens

Alignment Length:859 Identity:191/860 (22%)
Similarity:310/860 (36%) Gaps:193/860 (22%)


  Fly    62 TLTASPA-----KTAAFTVKTTRRRRSRRRAEGSSICVPIRRGQGSTPTPTIQVLQFVLVSLLAL 121
            |.||..|     :|:.|. :|.|..|..|...|...|    :.:.....|.|:.::.        
Human    73 TKTAGSASDKFQETSVFN-ETLRIERIARTQGGRYYC----KAENGVGVPAIKSIRV-------- 124

  Fly   122 LAKNAQAHNIPEDAVHITAILGEG-------VIFNCHVEFPNDHPVPYVLQWDKKVSET------ 173
               :.|..:.|...||.|.....|       |...|.|   |.:| |....| |:.|:|      
Human   125 ---DVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTV---NSNP-PARFIW-KRGSDTLSHSQD 181

  Fly   174 -GSDL--PIYIWYESYPEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKVVFLNRD 235
             |.|:  |:|...|                        :..|.|.|:|..|...|.|:|...|..
Human   182 NGVDIYEPLYTQGE------------------------TKVLKLKNLRPQDYASYTCQVSVRNVC 222

  Fly   236 PKQHKNGTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNC-QADGTPTPEILWYKDANPVDPSPT 299
            ....|..|:...:..|||...::..:.:.||.|:::.:.| ...|.|.|::.|.....|:    .
Human   223 GIPDKAITFRLTNTTAPPALKLSVNETLVVNPGENVTVQCLLTGGDPLPQLQWSHGPGPL----P 283

  Fly   300 VGIFNDGTELRISTIRHEDIGEYTCIARNGEGQ-VSHTARVIIAG--GAVIMVPPTNQTKLE--- 358
            :|....|..|.|.:::..|.|.|.|.|.|..|. ...|..:::..  .|...:.|....:.|   
Human   284 LGALAQGGTLSIPSVQARDSGYYNCTATNNVGNPAKKTVNLLVRSMKNATFQITPDVIKESENIQ 348

  Fly   359 -GEKVIFSCEAKAMP-GNVTVRWYREGSPVREVAALETRVTIRKD--------GSLIINPIKPDD 413
             |:.:..||...|:| ..||.:|::.|.|.|    :..|:.:.::        .||.:..:...|
Human   349 LGQDLKLSCHVDAVPQEKVTYQWFKNGKPAR----MSKRLLVTRNDPELPAVTSSLELIDLHFSD 409

  Fly   414 SGQYLCEVTNGIGDPQSASAYLSVEYP-AKVTFTPTVQYLPFRLAGVV--------QCYIKSSPQ 469
            .|.|||..:    .|.:....||||.. :..|..||:.....|....|        ||.::..|:
Human   410 YGTYLCMAS----FPGAPVPDLSVEVNISSETVPPTISVPKGRAVVTVREGSPAELQCEVRGKPR 470

  Fly   470 LQYVTWTK-DKR-LLEPYQMKDIVVMANGSLLFTRVNEEHQGQYAC--TPYNAQGTAGASGVMDV 530
             ..|.|:: ||. .|.|..: .:....:|.|...||:.:..|.|.|  ..||..........:.:
Human   471 -PPVLWSRVDKEAALLPSGL-PLEETPDGKLRLERVSRDMSGTYRCQTARYNGFNVRPREAQVQL 533

  Fly   531 LVRKPPAFTVEPETLYQRK-VGDSVEMHCDALEAEGTERPTIKWQRQEGEQL---------TESQ 585
            .|:.||  .|||.:...|: :|..|.:.|..|........:..| |.:|:.|         .|:.
Human   534 NVQFPP--EVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVW-RFKGQLLPPPPVVPAAAEAP 595

  Fly   586 RNRIKISGGNITIENLRREDFGYYQCVVSNEVATLMAVTQLVIEGTQPHAPYNITGKATES---- 646
            .:      ..:.::.:.|:..|.|:|.|||:|.:...:.|:..:...|.. |..|...|.|    
Human   596 DH------AELRLDAVTRDSSGSYECSVSNDVGSAACLFQVSAKAYSPEF-YFDTPNPTRSHKLS 653

  Fly   647 ---SITLQWLPGYSGGSEYKQDYTIWFREAGVNDWQTI-------SVTPSGSTQVTINGLASGTT 701
               |..|||........:...:|.:..|:  :|....:       .|......:..:..|....:
Human   654 KNYSYVLQWTQREPDAVDPVLNYRLSIRQ--LNQHNAVVKAIPVRRVEKGQLLEYILTDLRVPHS 716

  Fly   702 YEFQVVGRNVLGDG-MMSKVMTVRTLEDAPAAPRNVKAATQPPDSFFQLMPDEADLLAYF----- 760
            ||.::......|.| |.|:::..                |:|.:|     |:.:|...:|     
Human   717 YEVRLTPYTTFGAGDMASRIIHY----------------TEPINS-----PNLSDNTCHFEDEKI 760

  Fly   761 -----DIYFHTD-SRGTLVYSPPKLRVKGPKPGPPRNVSVTEVSNGFLITWQSPLE---RAHIV- 815
                 |:..:.| :|...:...||   :.|..|||.::|.|.......|....|.|   ||.:| 
Human   761 CGYTQDLTDNFDWTRQNALTQNPK---RSPNTGPPTDISGTPEGYYMFIETSRPRELGDRARLVS 822

  Fly   816 -------KFYTIKY 822
                   |||.:.:
Human   823 PLYNASAKFYCVSF 836

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 29/129 (22%)
IG_like 137..229 CDD:214653 25/108 (23%)
I-set 253..341 CDD:254352 22/90 (24%)
IGc2 268..331 CDD:197706 17/64 (27%)
I-set 346..437 CDD:254352 24/104 (23%)
Ig 349..437 CDD:299845 24/101 (24%)
Ig 459..530 CDD:299845 19/83 (23%)
IG_like 549..628 CDD:214653 18/89 (20%)
IGc2 551..617 CDD:197706 16/75 (21%)
FN3 633..725 CDD:238020 20/107 (19%)
FN3 786..874 CDD:238020 14/49 (29%)
MDGA1XP_006715119.1 IG_like 46..126 CDD:214653 14/69 (20%)
IGc2 52..115 CDD:197706 12/47 (26%)
IG_like 152..217 CDD:214653 23/94 (24%)
Ig 153..217 CDD:143165 23/93 (25%)
IG_like 248..326 CDD:214653 21/82 (26%)
IGc2 254..315 CDD:197706 17/65 (26%)
IGc2 350..418 CDD:197706 19/72 (26%)
IG_like 450..535 CDD:214653 19/87 (22%)
IGc2 455..515 CDD:197706 16/62 (26%)
Ig 541..622 CDD:299845 21/88 (24%)
IG_like 543..631 CDD:214653 20/95 (21%)
MAM 753..917 CDD:279023 21/88 (24%)
MAM 753..916 CDD:99706 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.