DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and Lrit1

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_647547.2 Gene:Lrit1 RGDID:628607 Length:623 Species:Rattus norvegicus

Alignment Length:649 Identity:126/650 (19%)
Similarity:220/650 (34%) Gaps:227/650 (35%)


  Fly    34 PLEIPEQRASKCRGDIDRTTTTTIPASKTLTASP--------------AKTAAFTVKTTRRRRSR 84
            |..||   ...|:..::||....:|..   |..|              ::.:...::..||.|..
  Rat    54 PASIP---PDTCKLRLERTAIRRVPGE---TFRPLSRLEQLWLPYNALSELSTLMLRGLRRLREL 112

  Fly    85 RRAEGSSICVPIRRGQGSTPTPTIQVLQFVLVSLLALLAKNAQAHNIPEDAVHITAILGEGVIFN 149
            |......:..|   ......||.:|:|.         |..| :...:|.:|||..    |.:.| 
  Rat   113 RLPGNHLVTFP---WAALKDTPQLQLLD---------LQAN-RLSTLPPEAVHFL----ENLTF- 159

  Fly   150 CHVEFPNDHPVPYVLQWDKKVSETGSDLPIYIWYESYPEHIEEG--YKGRVSRV---SQDSPFGS 209
              ::..|:.    :::..:::.:|        |     .|::.|  ...|.:|:   .||:|: .
  Rat   160 --LDLSNNQ----LMRLPEELLDT--------W-----AHLKTGPYLSSRRTRLVLGLQDNPW-V 204

  Fly   210 ASLNLTNIRESDQGWYECKVVFLNR-----DPKQHKNGTWFHLDVHAPPRFSVTPE-----DIIY 264
            ....|.::.....|| ...::|:..     .|:......:..|::    |...:||     ..|.
  Rat   205 CDCRLYDLVHLLDGW-ASNLIFIEARLRCGSPRSLAGVAFSQLEL----RKCQSPELRPGVTSII 264

  Fly   265 VNLGDSIILNCQADGTPTPEILWYK-DANPVDPSPTVGIFNDG---TELRISTIRHEDIGEYTCI 325
            ..||.:::|.|.|.|.|.||:.|.: :..|::.:....:.:||   |.|.:..:...|.|:|.|.
  Rat   265 SPLGSTVLLRCGATGIPGPEMSWRRANGRPLNGTVHQEVSSDGSSWTLLDLPVVSLFDSGDYICQ 329

  Fly   326 ARNGEGQVSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNVTVRWYREGSPVREVA 390
            |:|..|    .:..:|   ::|:..|...|:..|           :||.:   |.|.|... |.|
  Rat   330 AKNFLG----ASETLI---SLIVTEPQTSTEYTG-----------IPGAL---WARTGEGA-EAA 372

  Fly   391 ALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVEYPAKVTFTPTVQYLPFR 455
            |...::..|.      .|..|:                           |..:...|:|      
  Rat   373 AYNNKLVARH------VPHVPE---------------------------PVALATKPSV------ 398

  Fly   456 LAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEHQGQYACTPYNAQG 520
                        |.:      |::..|:.:|| |:    .|.  |:|...|||            
  Rat   399 ------------PSI------KEELPLQNFQM-DV----PGE--FSREPSEHQ------------ 426

  Fly   521 TAGASGVMDVLVRKPPAFTVEPETLYQRK---VGD---SVEMHCDALEAEGTERPTIKW----QR 575
                                  ||...|.   |||   ||.:...|.:|..|...::.:    ||
  Rat   427 ----------------------ETQMVRSLKVVGDTYHSVSLVWKAPQAGNTTAFSVLYAVFGQR 469

  Fly   576 QEGEQLTESQRNRIKISGGNITIENLRREDFGYYQCVV------SNEVATLMAVTQLV-IEGTQ 632
                   :.:|..::....::|||.|..:. .|..||.      :.|...:.:..::| .||||
  Rat   470 -------DMRRMTVEAGKTSVTIEGLAPKT-KYVACVCVRGLVPTKEQCVIFSTDEVVDAEGTQ 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 19/123 (15%)
IG_like 137..229 CDD:214653 16/97 (16%)
I-set 253..341 CDD:254352 26/97 (27%)
IGc2 268..331 CDD:197706 20/67 (30%)
I-set 346..437 CDD:254352 15/91 (16%)
Ig 349..437 CDD:299845 14/88 (16%)
Ig 459..530 CDD:299845 12/71 (17%)
IG_like 549..628 CDD:214653 20/96 (21%)
IGc2 551..617 CDD:197706 18/79 (23%)
FN3 633..725 CDD:238020 126/650 (19%)
FN3 786..874 CDD:238020
Lrit1NP_647547.2 LRRNT 23..61 CDD:214470 3/10 (30%)
LRR 1 60..81 5/24 (21%)
LRR_8 63..143 CDD:290566 16/96 (17%)
leucine-rich repeat 64..84 CDD:275378 5/23 (22%)
LRR 2 84..105 0/21 (0%)
leucine-rich repeat 85..132 CDD:275378 7/50 (14%)
LRR 3 108..128 4/23 (17%)
LRR_8 131..>176 CDD:290566 12/66 (18%)
LRR_4 131..172 CDD:289563 12/62 (19%)
LRR 4 132..153 8/31 (26%)
leucine-rich repeat 133..156 CDD:275378 9/37 (24%)
LRR 5 156..177 2/28 (7%)
leucine-rich repeat 157..180 CDD:275378 4/43 (9%)
leucine-rich repeat 181..205 CDD:275378 6/25 (24%)
TPKR_C2 201..>240 CDD:301599 6/41 (15%)
Ig 257..345 CDD:299845 25/95 (26%)
IG_like 267..345 CDD:214653 24/85 (28%)
FN3 431..501 CDD:214495 19/78 (24%)
LRR 6 525..548 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.