DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and Ptprq

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_001357916.1 Gene:Ptprq MGIID:1096349 Length:2301 Species:Mus musculus

Alignment Length:1629 Identity:319/1630 (20%)
Similarity:523/1630 (32%) Gaps:533/1630 (33%)


  Fly    36 EIPEQRASKCRGDIDRTTTTTIPASKTLT-ASPAKTAAFTVKTTRRRRSRRRAEGSSICVPIRRG 99
            ::||     |..:.|....:|...|.||: |:|      .::||....:..|.:.||:..     
Mouse   216 KLPE-----CNENSDSFLWSTTSPSPTLSRATP------PLRTTHLSNTLARNKISSVWK----- 264

  Fly   100 QGSTPTPTIQVLQFVLVS-------LLALLAKNAQAHNIPEDAVHITAILGEGVIFNCHVEFPND 157
                     :.:.||:..       |..:.|...:|..|....|.....:.||...||..  .|.
Mouse   265 ---------EPISFVVTHLRPYTTYLFEVSAVTTEAGYIDSTIVRTPESVPEGPPQNCIT--GNV 318

  Fly   158 HPVPYVLQWDKKVSETG---------------------------SDLPIYIWYESYPEHIEEGYK 195
            ....:.:.||.....||                           :.|..:..|:.|.........
Mouse   319 TGKAFSISWDPPAIVTGKFSYRVELYGPTGRILDNSTKDLRFVFTHLTPFTMYDVYVAAETSAGV 383

  Fly   196 GRVSRVS----QDSPFGSASLNL-----TNIRESDQGWYECKVVFLNRDPKQHKNGTWFHLDVHA 251
            |..|.:|    .|.|.....|.:     |.||.|   |         |.|:| .||......|  
Mouse   384 GPKSNLSVFTPPDVPGAVFDLQIVEVEATEIRVS---W---------RKPRQ-PNGIISQYRV-- 433

  Fly   252 PPRFSVTPEDIIYVN---LGDSIILNCQADGTPTPEILWYKDANPVDPSPTVGIFNDGTELRI-- 311
              :.||....:|..|   .|....:|    ...||||:     |.||  |.:|.:....|:..  
Mouse   434 --KVSVLESGVILENTLLTGQDEYIN----NPMTPEIM-----NLVD--PMIGFYEGSGEMSSDL 485

  Fly   312 ----------------STIRHEDIGEYTCIARNGEGQ----VSHTARVIIAGGAVIMVPPTNQTK 356
                            :..|.||......:|...:..    ..|.:.||..     :||.|..| 
Mouse   486 HSLASFIYNSHPHDFPARTRVEDQRSPVVVATRNQYMTDIAAEHLSYVIRR-----LVPFTEHT- 544

  Fly   357 LEGEKVIFSCEAKAMPGNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEV 421
                   .|..|..:.|        ||.|.  |..:.||..:  ..|:.|...|...|...|.  
Mouse   545 -------ISVSAFTVMG--------EGPPT--VLTVRTREQV--PSSIQIINYKNISSSSILL-- 588

  Fly   422 TNGIGDPQSASAYLSVEYP-AKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPY 485
               ..||.        ||| .|:|                          .|..:..:......:
Mouse   589 ---YWDPP--------EYPNGKIT--------------------------HYTIYAMELDTNRAF 616

  Fly   486 QMKDIVVMANGSLLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQR-K 549
            ||..:    :.|.|.|.:.:..:.:.........|.:..|...|:.||.|..   |||:..|. |
Mouse   617 QMTTV----DNSFLITGLKKYTRYKMRVAASTHVGESSLSEENDLFVRTPED---EPESSPQDVK 674

  Fly   550 VGDSVEMHCDALEAEGTERPT-------IKWQRQEGEQLTESQRNRIKISG------GNITIENL 601
            |.| |.....:|.....|:|.       :.:|..:...:..:....|.:|.      .||:|::.
Mouse   675 VTD-VSPSELSLTWSPPEKPNGIIIAYEVFYQNADALFVKNTSTTNITLSDLKPYTLYNISIQSY 738

  Fly   602 RREDFGYYQCVVSNEVATLMAVTQLVIEGTQPHAPYNITGKATES-SITLQWLPGYSGGSEYKQD 665
            .|...|       |:.::|::|.  ..|.....||.|||.|...| .|.:.:||..|... ..|.
Mouse   739 TRLGHG-------NQSSSLLSVR--TSETVPDSAPENITYKNISSEEIEIFFLPPRSPNG-IIQK 793

  Fly   666 YTIWFREAGVNDWQTISVTPSGSTQVTINGLASGTTYEFQVVGRNVLGDGMMSKVMTVRTLEDAP 730
            |||:.:.:..::.:||..|   |..:||.||...|.|..:|....:.|:|:.|..:::.|.||||
Mouse   794 YTIYLKRSNSHEARTIETT---SLTLTIGGLKKYTHYVIEVSASTLKGEGVRSMPISILTEEDAP 855

  Fly   731 -AAPRN----------VKAATQPPDSFFQLMPDEADLLAYFDIY--------------------- 763
             :.|:|          |..:.|||     |.|:  .::.|:.:|                     
Mouse   856 DSPPQNFSVKQLSGVTVMLSWQPP-----LEPN--GIILYYTVYVWDKVSLKTINATEVSLELSD 913

  Fly   764 --FHTD---------------SRGTLV-YSPPKLRVKGPKPGPPRNVSVTEVSNGFLIT-WQSPL 809
              :|.|               :|.::: :..|    :|....||::|....:|:..:|. |..|:
Mouse   914 LDYHADYSAYVTASTRFGDGKTRSSVINFRTP----EGEPSDPPKDVHYVNLSSSSIILFWTPPV 974

  Fly   810 ERAHIVKFYTIKYRTDAQWKTLNRGQIRPEETQYLVKNLVGGRTYYFRVLANSEKSYESSDEVKF 874
            :...|:::|::.|:..:  .|..:.....|.||......|..|.|...|.     ||.:      
Mouse   975 KPNGIIQYYSVYYQNTS--STFVQNFTLLEVTQEPGNVTVSARIYKLAVF-----SYYT------ 1026

  Fly   875 PVPARVKHKAITAGVVGGILFFIVAIILSVCAVKICNKRKRRKQEKEFNMVACRITDARNIAANN 939
                                |::.|..|      :.|..|                       ::
Mouse  1027 --------------------FWLTASTL------VGNGNK-----------------------SS 1042

  Fly   940 HHLHNRSTGSISSGQVPLKKYKQTRISSLTAILIAILHWIW-PPDRCTNCHSIYSSPNLEDGDED 1003
            ..:|..:...|..|.|....|:..   |.|||.::     | ||.:.......|.|.||:.....
Mouse  1043 DVIHVYTDQDIPEGGVGNLTYESL---SSTAINVS-----WTPPSQPNGLVFYYVSLNLQQSPPR 1099

  Fly  1004 DGGGGRRRSVSRIQRSL--DG-----RFVLDVEGVSKLGYSQQTLESGNV----DVVDGGLFERR 1057
            .    ||..::..:.|:  |.     .::..:...::.|:|:......::    ||.|.......
Mouse  1100 H----RRPPLTTYENSIYFDNLEKYTDYIFKITPSTEKGFSETYTAQLHIKTEEDVPDTPPIINT 1160

  Fly  1058 NSNVSQKS---SSD-----DGGFLS----------RRNFITARASWRRPLVASSSQLSLQSAADS 1104
            ..|:|..|   |.|     :|..||          .|.|:|   |....::...|..:|.|...:
Mouse  1161 FKNLSSTSILLSWDPPLKPNGAILSYHLTLQGTHANRTFVT---SGNHIVLEELSPFTLYSFLAA 1222

  Fly  1105 ARGFLQGLLKIGAKQSAVPPNSQSYF--DEAVSGARYQNV-LRPYTSS----------------- 1149
            || .::||          .|:|..:|  ||:...|..||: |..|||.                 
Mouse  1223 AR-TMKGL----------GPSSILFFYTDESAPLAPPQNLTLINYTSDFVWLTWSPSPLPGGIVK 1276

  Fly  1150 ----------------NNLYG---NADRSRPLHINTISGSLSQQQQLYTPSRISRIFSSSPQQLQ 1195
                            .|:.|   :|..:....::|.|.|:|...::...::.|.:...:.|:..
Mouse  1277 VYSFKIHEHETDTVFYKNISGFQTDAKLAGLEPVSTYSISVSAFTKVGNGNQFSNVVKFTTQESV 1341

  Fly  1196 PHHQQLLLSSGGSGAYPTHFSDLSTVY-PPNSA-----------ERSSHNLSSR---YRY----- 1240
            |...|.:      ......:..:|.:: ||..|           |.:|..:|.|   |.:     
Mouse  1342 PDAVQNI------ACVARDWQSVSVMWDPPRKANGIIIHYMITVEGNSTKVSPRDPMYTFTKLLA 1400

  Fly  1241 ---YSQELPSLRTIQEETRRQQQQKQHP--------------LEDHFVPLQLPSPPSWRSYYQSQ 1288
               |..|:.:..:..|....|......|              ::...|.|:...|.:...|:|  
Mouse  1401 NTSYIFEVRASTSAGEGNESQCNVSTLPETVPSVPTNTAFSNVQSTSVTLRWIKPDTILGYFQ-- 1463

  Fly  1289 ASYRPRTR--------WYPRHHSRLFSNRQQQHEMLSPLPQLNLNLRNSMNPGGLEASPESR--- 1342
             :|:..|:        |.|        ....:|:.:..|.:.|   :......||:.....|   
Mouse  1464 -NYKITTQLRAQKCREWEP--------EECVEHQEVQYLYEAN---QTEDTVRGLKKFQWYRFQV 1516

  Fly  1343 --SSSSGFGSKNTSNHPGSTSEWRLLPPYRAPP-SPPKHSGYFGGQQAQGQTPHG---SYSYPRA 1401
              |:::|:         |:.|.|........|| .||::      .:....:|.|   |::.|..
Mouse  1517 AASTNAGY---------GNASSWISTQTLPGPPDGPPEN------VRVVATSPFGINISWNEPAI 1566

  Fly  1402 TTPP 1405
            .|.|
Mouse  1567 ITGP 1570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 29/149 (19%)
IG_like 137..229 CDD:214653 23/128 (18%)
I-set 253..341 CDD:254352 23/113 (20%)
IGc2 268..331 CDD:197706 16/81 (20%)
I-set 346..437 CDD:254352 20/91 (22%)
Ig 349..437 CDD:299845 20/88 (23%)
Ig 459..530 CDD:299845 9/71 (13%)
IG_like 549..628 CDD:214653 18/92 (20%)
IGc2 551..617 CDD:197706 14/79 (18%)
FN3 633..725 CDD:238020 29/93 (31%)
FN3 786..874 CDD:238020 20/89 (22%)
PtprqNP_001357916.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.