DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tutl and kirrel1b

Sequence 1:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio

Alignment Length:802 Identity:183/803 (23%)
Similarity:283/803 (35%) Gaps:235/803 (29%)


  Fly   139 TAILGEGVIFNCHVEFPNDHPVPY--VLQWDKK--VSETGSDLPIYIWYESYPEHIEEGYKGRVS 199
            :.::||.|:.:|.|       ..|  ::||.|.  ....|.||      .::|.:       ||.
Zfish    35 SVVIGERVVLSCVV-------FNYTGIVQWTKDGLALGIGEDL------RAWPRY-------RVL 79

  Fly   200 RVSQDSPFGSASLNLTNIRESDQGWYECKVVFLNRDPKQHKNGTWFHLDVHAPPRFSV---TPED 261
            |:..   .|..:|.:|:...:|...|||:........::.|      |.|..||...|   :|| 
Zfish    80 RIMD---VGQYNLEITSADLTDDSLYECQATEAALRSRRAK------LTVLIPPDGPVIEGSPE- 134

  Fly   262 IIYVNLGDSIILNCQADGT-PTPEILWYKDANPVDPSPTVGIFNDGTEL-----RISTIRHEDI- 319
             |.:..|.|..|.|.:.|. |...|.||||...|:.:.|      .||:     |::|....:| 
Zfish   135 -ILLTAGTSFNLTCVSRGAKPMSTIEWYKDGIIVEGAHT------STEVLSDRKRVTTKSFLEIQ 192

  Fly   320 -------GEYTCIARNGEGQVSHTARVIIAGGAVIMVPPT------NQTKLEGEKVIFSCEAKAM 371
                   ..:||:|.|....:...:.|.:.    |..|||      .::.||||:|.|:|:|.|.
Zfish   193 PMDTDTGRNFTCVASNLAAPLGKRSTVTLN----IHHPPTVILSIEPRSVLEGERVKFTCQATAN 253

  Fly   372 PGNVTVRWYREG---SPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASA 433
            |..:..||.:.|   ...|| :..||..    |.|....|:.        |.|.|.:|. .:.|.
Zfish   254 PPIMGYRWAKGGVILDGARE-SVFETTA----DHSFFTEPVS--------CLVFNAVGS-TNVSI 304

  Fly   434 YLSVEYPAKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSL 498
            .:.|.:...:...|....:.......:.|....:|.|. :||||         ....:|::|.:.
Zfish   305 LVDVHFGPILVVEPRPVTVDVDSDVTLNCKWSGNPPLT-LTWTK---------KGSSMVLSNSNQ 359

  Fly   499 LFTR-VNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHC---- 558
            ||.: |::...|||.|.....:...|.:.| .:.|..||..:.||.....|  |:..|:.|    
Zfish   360 LFLKSVSQADAGQYVCKAIVPRIGVGETEV-TLTVNGPPIISSEPIQYAVR--GEKGEIKCYIAS 421

  Fly   559 ----DALEAEGTERPTIKWQRQEG---EQLTESQRNRIKISGG----NITIENLRREDF-GYYQC 611
                |.:.....|.   .|:::.|   |:.|..| :|....||    .:||.|:...|| ..|.|
Zfish   422 TPPPDKIVWAWKEN---VWEKERGTLLERYTVEQ-SRPATQGGAVLSTLTINNVMEADFQSTYNC 482

  Fly   612 VVSNEVAT-LMAVTQLVIEGTQPHAPYNITGKATESSITLQWLPGYSGGSE-------------- 661
            ...|.... .|.:|   :|.|.         .|:|..:.:..:.|.|.||.              
Zfish   483 TAWNAFGPGTMIIT---LEETD---------IASEDIVPVGVIAGGSVGSSILLLLLLFALIFYL 535

  Fly   662 YKQDYTIWFREAGVNDWQTISVTPSGSTQVTINGLASGTTYEFQVVGRNVLGDGMMSKVMTVR-- 724
            |:|      |::.                      ..|.|.:..:            ||.||.  
Zfish   536 YRQ------RKSS----------------------RRGVTLKPDI------------KVETVNKE 560

  Fly   725 -TLED----APAAPRNVKA------------ATQPPDSFFQLMPD-EADLL-------------- 757
             .||:    |..|.|.|||            :|||......|..| :.:.|              
Zfish   561 TNLEEEAASASTATRMVKAMYSFLPSVSLSPSTQPFKDDMDLKQDLQTETLEPKVEEYEAKDPTN 625

  Fly   758 AYFDIYFHT-----DSRGTLVYSPPKLRVKGPKPGPPRNVSVTEVSNGFLITWQSPLERAHIVKF 817
            .|:::...|     .|..:|:|.    ..:.|.|     .||:..:.|......:|..|......
Zfish   626 GYYNVRATTHDEVRSSTRSLLYQ----EFRAPNP-----ASVSASTGGPANIHPAPTGRYEARPT 681

  Fly   818 YTIKYRTDAQWKTLNR-GQIRP 838
            ..:.:.|.|.:.|:.| .||:|
Zfish   682 SRMAHNTYAHFNTIARASQIQP 703

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 26/115 (23%)
IG_like 137..229 CDD:214653 23/94 (24%)
I-set 253..341 CDD:254352 28/105 (27%)
IGc2 268..331 CDD:197706 22/77 (29%)
I-set 346..437 CDD:254352 29/100 (29%)
Ig 349..437 CDD:299845 28/97 (29%)
Ig 459..530 CDD:299845 18/72 (25%)
IG_like 549..628 CDD:214653 23/96 (24%)
IGc2 551..617 CDD:197706 21/82 (26%)
FN3 633..725 CDD:238020 15/109 (14%)
FN3 786..874 CDD:238020 13/55 (24%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.