DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fs(1)N and Bsph2

Sequence 1:NP_569901.1 Gene:fs(1)N FlyBaseID:FBgn0004650 Length:2118 Species:Drosophila melanogaster
Sequence 2:NP_001074411.1 Gene:Bsph2 MGIID:1924934 Length:131 Species:Mus musculus

Alignment Length:107 Identity:19/108 (18%)
Similarity:41/108 (38%) Gaps:20/108 (19%)


  Fly   525 LEIRQFMQDWVHEQEELIQLAEELLAEKSESQYIEELST-----PLVVSEGGTVEELFV-NEARW 583
            :|:...:..||.....:.:|..||::.....:  :|:||     |.|.::|.....:.: ::..|
Mouse     1 MEVMSHLVHWVFLAVYMYELNAELISHLHPPE--QEISTDSCVFPFVYADGFHYSCISLHSDYDW 63

  Fly   584 TGADAVVDVSSLLQQILLLDGEMSSRRSKRQPETLFNFHYEQ 625
            ...|            ....|......::..|:.:|.|.::|
Mouse    64 CSLD------------FQFQGRWRYCTAQDPPKCIFPFQFKQ 93

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fs(1)NNP_569901.1 None
Bsph2NP_001074411.1 FN2 40..77 CDD:299134 6/49 (12%)
fn2 85..126 CDD:278469 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22918
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.