DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fs(1)N and Bsph1

Sequence 1:NP_569901.1 Gene:fs(1)N FlyBaseID:FBgn0004650 Length:2118 Species:Drosophila melanogaster
Sequence 2:NP_001028590.1 Gene:Bsph1 MGIID:2685613 Length:133 Species:Mus musculus

Alignment Length:60 Identity:19/61 (31%)
Similarity:26/61 (43%) Gaps:9/61 (15%)


  Fly  1999 IQLHHANGSLFQTLAGEHGARHLTSLRVRDETLLAFMEGCCRIRVLIYRGVQGFVDFVRF 2058
            |.|.|   |||.....::.|..:.||....||    .:|.| :...:||. :.|.|.|.|
Mouse    12 ICLFH---SLFSFQVEDYYAPTIESLIRNPET----EDGAC-VFPFLYRS-EIFYDCVNF 62

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fs(1)NNP_569901.1 None
Bsph1NP_001028590.1 fn2 90..131 CDD:278469
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22918
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.