DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fs(1)N and Bsph2

Sequence 1:NP_569901.1 Gene:fs(1)N FlyBaseID:FBgn0004650 Length:2118 Species:Drosophila melanogaster
Sequence 2:XP_008772650.2 Gene:Bsph2 RGDID:2323789 Length:171 Species:Rattus norvegicus

Alignment Length:67 Identity:18/68 (26%)
Similarity:28/68 (41%) Gaps:9/68 (13%)


  Fly   895 LPVDAHIADNQLSGIF---LNDFVTKH---TPQTLSNLSQLGGYVY---FHQLELGKESSYDGVR 950
            |.|.:|:....|..::   ||..:..|   ..|..||.:.:..:||   ||...:...|.||...
  Rat    42 LEVMSHLVGWALLAVYIYGLNAELISHLHPPKQDFSNTTCVFPFVYADEFHYSCISIRSDYDWCS 106

  Fly   951 LE 952
            |:
  Rat   107 LD 108



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22918
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.