DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lds and CG10445

Sequence 1:NP_524850.2 Gene:lds FlyBaseID:FBgn0002542 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster

Alignment Length:992 Identity:351/993 (35%)
Similarity:503/993 (51%) Gaps:169/993 (17%)


  Fly   192 LDDSSGSDVLILSNKETPIEILSSTDDDATTNKENMSGPPFERPSKSLSPRSSAGASVVKTSKNL 256
            ::.||.||...:..:...|:..||.....::.:.|....|....|..||...:...|.:..|   
  Fly     1 MESSSPSDTTEIHKQSCSIQDQSSVPVPDSSGEINNWMEPEPVDSLELSGEYADNESAIFVS--- 62

  Fly   257 SQPTIQAVLKQKTSPAAPRRSRIKSEDQKVVSQVVYDEEMRKLAEKRVQVSDAEKLFEKVAHKLP 321
                        .|....::::|....||:::......::.:.|.:..::.|.:...||:..:|.
  Fly    63 ------------ASEYNEKKAQIDQLVQKILTMEQQQRQLEENASETKELCDLKLHLEKLNARLE 115

  Fly   322 DKGSQIMKRIDTLRRELAMDEQWISALRVQQSNVPAVRVVKPTLNPPRAPSIDTLDWDELSEAVN 386
            ..|    :.:||||  |..|:|   .::::.::    .:|..|..|         .|..|...:|
  Fly   116 ALG----EFLDTLR--LREDQQ---EIKIEDNS----ELVDHTEQP---------KWSNLYSGLN 158

  Fly   387 EI--KPVYTGAQGMATFNNQKALTLESLKDLHVSLEDLPGPEVLAEDPVGLKVSLMNHQKHALAW 449
            ..  |..:|.||    |...|:..::|||.|:..::..|..:.|.:.|..|.|.|:.||:..|.|
  Fly   159 RYRQKANHTAAQ----FYQHKSNIIDSLKTLYEPIQPRPAIDDLEKQPALLLVRLLKHQQSCLKW 219

  Fly   450 MSWRERKLPRGGILADDMGLGKTLTMISSVLA----------------------------CKNGQ 486
            |.:|||:...||||||||||||||:||:.:||                            ||..:
  Fly   220 MQFRERQKISGGILADDMGLGKTLSMIALILASEETKNRKREEKKKALTLKWTQEFNRVYCKEIR 284

  Fly   487 EMSEGKDESSDSDSE--------------------------DDKNKKRKSVTGWKSK-------- 517
            ::|...||......|                          ||.:...|:|...:.|        
  Fly   285 KISMFDDEEESGKEEEQYEPPEKRTCHVKTKKINQFRILDDDDNDAGDKAVVEDEQKDLLAKTPE 349

  Fly   518 ---------------GRKDTRRGGTLVVCPASLLRQWESEVESKVSRQKLTVCVHHGNNRETKG- 566
                           ||..:  ..||||||.|::.||..||.|||::..:.|...||.||...| 
  Fly   350 PEVFSSDEEEEHLSNGRYPS--ANTLVVCPMSVMCQWAHEVASKVAQNAIRVLTFHGPNRHEIGI 412

  Fly   567 KYLRDYDIVVTTYQIVAREHK---SLSAVFGVKWRRIILDEAHVVRNHKSQSSLAVCDLRGKYRW 628
            :..|.||:|:|:|.:|..|.|   :.|.:|.|.|.|:||||||::||.|:....:||.||....|
  Fly   413 EAFRSYDLVITSYNLVVNELKRYGNTSPLFAVYWNRVILDEAHIIRNSKTNCCNSVCQLRAHCHW 477

  Fly   629 ALTGTPIQNKELDVYALLKFLRCSPFDDLHTWKKWIDNKSAGGQNRLNLLMKSLMLRRTKAQLQS 693
            ||||||:||:.:||:|||:|:....|.||..|||.: |:|..|..|||.::|.|||||||.:||:
  Fly   478 ALTGTPVQNRGVDVFALLRFVNVPNFQDLQQWKKNL-NESMLGHRRLNFIIKPLMLRRTKQKLQA 541

  Fly   694 DGKLNSLPNKELRLIEISLDKEEMNVYQTVMTYSRTLFAQFLHQRAERETDFNYRSDANKPTYNQ 758
            .|.:.:||:.::.||.:.|.|.||.|||.:...|:.:|.|||.||.:..:|.||.|....|.:..
  Fly   542 SGDMPALPSLKIELICVQLSKTEMAVYQILSAISKKIFTQFLLQREKGNSDLNYYSLERTPQFIA 606

  Fly   759 IKDPNGAYYKMHEKFARMAGSK--KEVKSHDILVLLLRLRQICCHPGLIDAMLDG----EESQTM 817
            ....:..|.:::|:|.:..|..  :::....||||||||||.||||||:..||.|    |:.|.:
  Fly   607 GHMSDERYNEIYERFLKSLGYNPGEKILGIYILVLLLRLRQFCCHPGLMIGMLRGALTAEDVQNV 671

  Fly   818 GDHSSDSDTP-EIDLLAQLNKLAITD-----------TSTDG------------QQSVA-NAGDD 857
            ...:||.:.. ::|:||:|:|...||           |..||            :::|. ::|||
  Fly   672 KVDASDVEGQLKMDVLAELDKFDETDSEDDCCDEEDSTRRDGNFKLEVIKDEIKEENVPWDSGDD 736

  Fly   858 GPPL--LPDEARIAKASKNLLKRSNPVFNLHRPSSKINMVIQILKTSILKSSDDKAIVVSQWTSV 920
            .|..  ..|:...|:|.| ||...||:|...|||:|:.|||..|: .:|..::||.||.|||.|.
  Fly   737 LPTASSFEDQLDSARALK-LLNPQNPIFQFIRPSAKLKMVIDKLE-ELLTGTNDKIIVTSQWVSY 799

  Fly   921 LDILRDHLSKDGVATLSLNGTIPVKNRQDIVNEFNDRNNQKRVLLLSLTAGGVGLNLIGANHLLL 985
            |.|:|..|......||..||.:..|.|:.::.:|| .||:|||||||||||||||||..|||:|:
  Fly   800 LAIVRKRLQDLSWETLDFNGQLTAKEREIVLRDFN-ANNEKRVLLLSLTAGGVGLNLNVANHMLI 863

  Fly   986 LDLHWNPQLEAQAQDRIYRVGQKKNVIIYKFMCVDTVEQRIKGLQDKKLDLADGVL--TGAKVS- 1047
            :|||||||||.||||||||.||.|...||::||.||||||||.|||.||::|..||  .|.:|: 
  Fly   864 VDLHWNPQLERQAQDRIYRYGQTKPTFIYRYMCQDTVEQRIKSLQDCKLEIAKVVLPEEGGEVTK 928

  Fly  1048 ---SKLTIDDLKGLFGM 1061
               ..|.:.:||.||.|
  Fly   929 CVGGGLNLAELKKLFEM 945

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ldsNP_524850.2 SNF2_N 442..805 CDD:278600 167/446 (37%)
DEXDc 459..634 CDD:238005 84/256 (33%)
HELICc 885..1014 CDD:238034 73/129 (57%)
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 167/446 (37%)
DEXDc <372..483 CDD:238005 53/111 (48%)
HELICc 761..892 CDD:238034 75/133 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C138580367
eggNOG 1 0.900 E1_COG0141
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 395 1.000 Inparanoid score I1111
Isobase 1 0.950 0 Normalized mean entropy S3486
OrthoDB 1 1.010 D132523at2759
OrthoFinder 1 1.000 FOG0003166
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45626
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2250
87.970

Return to query results.
Submit another query.