DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lds and Marcal1

DIOPT Version :8

Sequence 1:NP_524850.2 Gene:lds / 45894 FlyBaseID:FBgn0002542 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_608883.1 Gene:Marcal1 / 33709 FlyBaseID:FBgn0031655 Length:755 Species:Drosophila melanogaster

Alignment Length:910 Identity:177/910 - (19%)
Similarity:305/910 - (33%) Gaps:280/910 - (30%)


  Fly   160 TAEAVVPRYTTQFAGNIQNDLHSTIGAADSEVLDDSSGSDVLILSNKETPIEILSSTDDDATTNK 224
            :|.|...:.||...|..|   |:..|.::..            ....::|:....|...:  ..|
  Fly    30 SAPATNGKSTTSATGATQ---HANNGKSNPN------------QPQAKSPLNFYRSPTGE--QKK 77

  Fly   225 ENMSGPPFERPSKSLSPRSSAGASVVKTSKNLSQPTIQAVLKQKTSPAAPRRSRIKSEDQKVVSQ 289
            .|.|||         :|..:..:|.:...|.:.|.:.:.:.:....|.  :|....:|..|....
  Fly    78 INRSGP---------TPGDNKSSSFLNALKAIKQTSNRELSRGAAHPY--QRPNGGNERNKPTLS 131

  Fly   290 VVYDEEMRKLAEKRVQV----SDAEKLFEKVAHKLPDKGSQIMKRIDTLRRELAMDEQWISALRV 350
            :..|:      ||.|.|    |....|:....|:...:.|             ...||.::..: 
  Fly   132 LSSDK------EKPVAVLLGNSITCNLYLISTHRFAAQTS-------------GYHEQLVTVFK- 176

  Fly   351 QQSNVPAVRVVKPTLNPPRAPSIDTLDWDELSEAVNEIKPVYTGAQGMATFNNQKALTLESLKDL 415
               |:|    .|......|..|.|..|:..|.....::|| |....|:.    :|.|      ||
  Fly   177 ---NMP----TKCYDGQTRIWSFDLSDYQSLKTHAADLKP-YVHMNGIP----KKVL------DL 223

  Fly   416 HVSLEDLPGPEVLAEDPVGLKVSLMNHQKHALAWMSWRERKLPRGGILADDMGLGKTLTMISSVL 480
            ......:|...|||.....|...||..|:..:.:...::.::    ::.|:||||||...::   
  Fly   224 CGQPPVVPERSVLASIEPKLADQLMPFQQDGVCFAIAQKGRI----MICDEMGLGKTYQALA--- 281

  Fly   481 ACKNGQEMSEGKDESSDSDSEDDKNKKRKSVTGWKSKGRKDTRRGGTLVVC-PASLLRQWESEVE 544
                          .:|...:|           |            .|:|| .||....|...:.
  Fly   282 --------------VADYFKDD-----------W------------PLLVCTTASTRDSWAKHIM 309

  Fly   545 SKVSRQKLTVCVHHGNNRETKGKYLRDYDIVVTTYQIVAR-EHKSLSAVFGVKWRRIILDEAHVV 608
            ..:.:    |.:|:.........|:.:..:::|:|.::.| |.|.:...||.    ||.||:|.:
  Fly   310 DLLPK----VPIHYVQVLNNNQLYVGEAKVLITSYNMMERHEDKLMQRKFGF----IIFDESHTL 366

  Fly   609 RNHKSQSSLAVCDL--RGKYRWALTGTPIQNKELDVYALLKFLRCSPFDDLHTWKKWIDNK---- 667
            :|.|::.:.....|  :.|....|:|||..::.|:::..|:.:.....:.:....::.|.|    
  Fly   367 KNSKAKCTTTAKRLTDQAKRVVLLSGTPALSRPLELFTQLQMIDGKFMNFMEFTTRYCDGKQSTF 431

  Fly   668 --SAGGQNRLN----LLMKSLMLRRTKAQLQSDGKLNSLPNKELRLIEISLDKEEMNVYQTVMTY 726
              .|.||:.|.    :|....||||||.::                                   
  Fly   432 GWDANGQSNLEELKVILHLKYMLRRTKVEV----------------------------------- 461

  Fly   727 SRTLFAQFLHQRAERETDFNYRSDANKPTYNQIKDPNGAYYKMHEKFARMAGSKKEVKSHDILVL 791
                    |.|.||                                           |:.:.:||
  Fly   462 --------LPQLAE-------------------------------------------KNRETVVL 475

  Fly   792 LLRLRQICCHPGLIDAMLDGEESQTMGDHSSDSDTPEIDLLAQLNKLAITDTSTDGQQSVANAGD 856
                     .|.|:  ..:.|..:|:...:.:..|.:                            
  Fly   476 ---------DPALV--WTNAETKETLDAFNKELKTAK---------------------------- 501

  Fly   857 DGPPLLPDEARIAKASKNLLKRSNPVFNLHRPSSKINMVIQILKTSILKSSDDKAIVVSQWTSVL 921
                        .:|::.:|.|    |.......|...|...|||  |.....|.|:.:....::
  Fly   502 ------------GRATEEILLR----FYARTAEVKTRAVCAYLKT--LVKEQKKFIIFAHHRVMM 548

  Fly   922 DILRDHLSKDGVATLSLNGTIPVKNRQDIVNEFNDRNNQKRVLLLSLTAGGVGLNLIGANHLLLL 986
            |.:.|.||...|..:.::|.....:|.|.|:.|..:::.| |.||||.|...|:.|..|..::..
  Fly   549 DAISDFLSGLKVHYIRIDGQTRSDHRSDSVDTFQKKSSCK-VALLSLKACNSGITLTAAEIIVFA 612

  Fly   987 DLHWNPQLEAQAQDRIYRVGQKKNVIIYKFMCVDTVEQRIKGLQDKKLDLADGVLTGAKVSSKLT 1051
            :|.|||...|||:.|.:|:||.|.||....:..:|.:..|..:...|.::...|...|:...|.|
  Fly   613 ELDWNPSTLAQAESRAHRIGQTKPVICRYLIAHNTADDIIWNMLKNKQEVLSKVGIFAENLQKAT 677

  Fly  1052  1051
              Fly   678  677

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ldsNP_524850.2 SNF2_N 442..805 CDD:278600 63/376 (17%)
DEXDc 459..634 CDD:238005 37/178 (21%)
HELICc 885..1014 CDD:238034 42/128 (33%)
Marcal1NP_608883.1 HARP 160..215 CDD:284784 14/76 (18%)
DEXDc 239..420 CDD:214692 45/232 (19%)
DEXDc 265..394 CDD:238005 37/180 (21%)
Helicase_C 518..632 CDD:278689 37/116 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C138573382
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.